KEGG   Homo sapiens (human): 5330Help
Entry
5330              CDS       T01001                                 

Gene name
PLCB2, PLC-beta-2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04062  Chemokine signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04310  Wnt signaling pathway
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04621  NOD-like receptor signaling pathway
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04742  Taste transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing syndrome
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
hsa05010  Alzheimer disease
hsa05016  Huntington disease
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Network
N00291  CaSR-PTH signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00407  HCMV UL33 to GNAQ-PLCB/G-calcineurin signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00546  CXCL12-CXCR4-PKC-ERK signaling pathaway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5330 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5330 (PLCB2)
   04310 Wnt signaling pathway
    5330 (PLCB2)
   04371 Apelin signaling pathway
    5330 (PLCB2)
   04020 Calcium signaling pathway
    5330 (PLCB2)
   04070 Phosphatidylinositol signaling system
    5330 (PLCB2)
   04072 Phospholipase D signaling pathway
    5330 (PLCB2)
   04071 Sphingolipid signaling pathway
    5330 (PLCB2)
   04022 cGMP-PKG signaling pathway
    5330 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    5330 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    5330 (PLCB2)
   04621 NOD-like receptor signaling pathway
    5330 (PLCB2)
   04062 Chemokine signaling pathway
    5330 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    5330 (PLCB2)
   04922 Glucagon signaling pathway
    5330 (PLCB2)
   04912 GnRH signaling pathway
    5330 (PLCB2)
   04915 Estrogen signaling pathway
    5330 (PLCB2)
   04921 Oxytocin signaling pathway
    5330 (PLCB2)
   04926 Relaxin signaling pathway
    5330 (PLCB2)
   04918 Thyroid hormone synthesis
    5330 (PLCB2)
   04919 Thyroid hormone signaling pathway
    5330 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    5330 (PLCB2)
   04916 Melanogenesis
    5330 (PLCB2)
   04924 Renin secretion
    5330 (PLCB2)
   04925 Aldosterone synthesis and secretion
    5330 (PLCB2)
   04927 Cortisol synthesis and secretion
    5330 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5330 (PLCB2)
   04270 Vascular smooth muscle contraction
    5330 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    5330 (PLCB2)
   04971 Gastric acid secretion
    5330 (PLCB2)
   04972 Pancreatic secretion
    5330 (PLCB2)
   04973 Carbohydrate digestion and absorption
    5330 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    5330 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    5330 (PLCB2)
   04725 Cholinergic synapse
    5330 (PLCB2)
   04728 Dopaminergic synapse
    5330 (PLCB2)
   04726 Serotonergic synapse
    5330 (PLCB2)
   04720 Long-term potentiation
    5330 (PLCB2)
   04730 Long-term depression
    5330 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    5330 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    5330 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    5330 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    5330 (PLCB2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    5330 (PLCB2)
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    5330 (PLCB2)
   05016 Huntington disease
    5330 (PLCB2)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    5330 (PLCB2)
   04934 Cushing syndrome
    5330 (PLCB2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    5330 (PLCB2)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    5330 (PLCB2)
   05142 Chagas disease (American trypanosomiasis)
    5330 (PLCB2)
   05143 African trypanosomiasis
    5330 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5330 (PLCB2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     5330 (PLCB2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5330 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    5330 (PLCB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 Gp58
Motif
Other DBs
NCBI-GeneID: 5330
NCBI-ProteinID: NP_004564
OMIM: 604114
HGNC: 9055
Ensembl: ENSG00000137841
Vega: OTTHUMG00000172412
Pharos: Q00722(Tbio)
UniProt: Q00722 Q59F77
Structure
PDB: 

Position
15q15.1
AA seq 1185 aa AA seqDB search
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKAWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINAQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGPTSSSKDTGGE
AEGSSPPSAPAGEGTVWAGEEGTELEEEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFVSFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGL
PEKPFPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAEPRTASLEELRELKGVVK
LQRRHEKELRELERRGARRWEELLQRGAAQLAELGPPGVGGVGACKLGPGKGSRKKRSLP
REESAGAAPGEGPEGVDGRVRELKDRLELELLRQGEEQYECVLKRKEQHVAEQISKMMEL
AREKQAAELKALKETSENDTKEMKKKLETKRLERIQGMTKVTTDKMAQERLKREINNSHI
QEVVQVIKQMTENLERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKE
SVRACLRTCFPSEAKDKPERACECPPELCEQDPLIAKADAQESRL
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggatgatgaaactacagttgcctctccagttatcctccgtgtg
gatcctaagggctactacttatactggacgtatcaaagtaaggagatggagtttctggat
atcaccagcatccgggatactcgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggacgtcttcaacatggactttcctgataacagtttcctgctgaagacactcacg
gtggtgtccggcccggacatggtggacctcaccttccacaacttcgtctcctacaaggag
aacgtgggcaaggcctgggctgaggacgtactggccctagtcaaacatccgctgacggcc
aacgcctcccgcagcaccttcctggacaagatccttgtgaagctcaagatgcagctcaac
tctgaagggaagattccggtgaagaactttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgctctcagtgcctgccacctccccaaaggcaaaaatgacgccatcaatcct
gaggacttcccagaacctgtctacaagagtttcctcatgagcctctgtcctcggccagaa
atagatgagatcttcacttcttaccatgctaaggccaaaccctacatgacgaaggagcac
ctgaccaaattcatcaaccagaaacagcgggactcccggcttaactccctgctgttcccg
ccagcacggcctgaccaggtgcagggcctcatcgacaagtatgagcccagtggcatcaat
gcacagaggggccagctgtcacctgaaggcatggtctggtttctctgtgggccagagaac
agcgtgctggcccaggacaagctgctgctccaccacgacatgacgcagccactcaatcat
tacttcatcaactcgtcccacaacacctacctgacagccggccagttctcaggcctctcc
tcggctgagatgtaccgccaggtgctgctctctggctgccgttgcgtggagctagactgc
tggaaggggaaaccccctgacgaggagcccattatcacccatggcttcaccatgaccaca
gacatcttcttcaaagaagcaattgaggctattgcagaaagcgcctttaagacctccccc
tatcccatcatcctgtcgtttgagaaccatgtggactcaccccgccagcaggctaagatg
gctgagtattgccggacgatctttggggatatgctgctcacagagcccctggaaaagttc
ccactaaaaccaggtgtccccctgcccagccctgaggatctcaggggcaagatcctcatc
aagaacaagaagaaccagttttctggccccacctcctccagtaaggatactggtggggag
gctgagggcagcagcccacccagtgcccctgcaggtgagggcacagtgtgggctggcgag
gaagggactgagctggaggaggaggaggtggaagaggaagaggaggaggagtcaggaaac
ctggatgaagaagagattaagaagatgcagtcggatgagggcacagcgggcctggaagtg
acggcttatgaggagatgtccagcctagtcaattacatccagcccaccaagttcgtctcc
tttgagttctctgcccaaaagaaccgaagttatgtcatctcgtccttcacagagctcaag
gcatatgacctgctctccaaggcctcggtgcagtttgtggactacaacaagcgccagatg
agccgcatttaccccaagggaacccgcatggactcctccaactacatgccccagatgttc
tggaatgctggatgccagatggttgccctcaacttccagacgatggacttgcccatgcag
cagaacatggcagtatttgagttcaacgggcagagcggctacctcctcaagcatgagttc
atgcgccggccggacaagcagttcaaccccttctcagtggaccgcatcgacgtggtggtg
gccaccaccctttccattacggtgatctctgggcagttcctgtcagaacgcagcgtgcgc
acctatgtagaagtggagctgtttggccttcctggggaccccaagaggcgctatcgaact
aagctgtcacccagtactaactccatcaatcctgtctggaaggaggagccctttgtcttt
gagaagatcttgatgcctgagctggcctccctcagagtggctgtgatggaggaaggcaac
aagtttcttggacaccgcatcatccccatcaatgccctaaattctgggtaccaccacctg
tgcctgcacagtgagagcaacatgcccctcaccatgcctgcgctcttcatcttcctggag
atgaaggactacatacctggtgcttgggcagatctcactgtggccctcgccaaccccatt
aagttcttcagtgcccatgacacgaagtctgtgaagctcaaggaggccatgggaggtctg
cctgagaagcccttcccactggcgagtccagttgccagccaggtcaatggggcgttggcc
ccaacgagcaatgggtcaccagcagccagggccggggccagggaagaggctatgaaagaa
gctgcggagccgcggaccgccagcctggaggagctccgggagctaaagggcgtggtgaag
ctgcagcggcggcacgagaaggagctgcgagagttggagcggcgcggagcgcggcgctgg
gaggagctgctgcagcggggcgcggcgcagctggcggagctcgggccaccgggcgtgggg
ggcgtcggggcctgcaagctcggtcccggcaagggctctcgcaagaagaggagcctgccc
cgcgaggagagcgccggagccgcgccgggcgagggccctgagggcgtggacgggcgcgtg
cgggagctgaaagacaggctggagctggagctgctgcggcagggcgaggagcagtacgag
tgcgttctgaagcgcaaggagcagcacgtggccgagcaaatctccaaaatgatggagctg
gccagagagaaacaggcggcagagctgaaggccctgaaggagacgtcggagaacgacacc
aaagagatgaagaaaaagctggagacaaagagactggagcggatccagggcatgaccaaa
gtcaccacagacaagatggcccaggagaggttgaagagagagattaacaactcccacatc
caggaagtagtgcaggtgatcaagcagatgacggagaacttggagaggcaccaggagaag
ctggaggagaagcaggcggcttgcctggaacagatacgggagatggaaaagcagttccag
aaggaggcgctggcagagtacgaggccaggatgaagggtctggaggcagaggtgaaggag
tcggtgagggcctgcctcaggacctgctttccctccgaggccaaggacaagcctgagagg
gcctgcgagtgccccccagagctgtgtgagcaggacccactcatagcaaaggcagatgcc
caggagagccgcctctga

DBGET integrated database retrieval system