KEGG   Homo sapiens (human): 53344
Entry
53344             CDS       T01001                                 
Symbol
CHIC1, BRX
Name
(RefSeq) cysteine rich hydrophobic domain 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Erf4 Tim54 Presenilin RNA_pol_Rpc4 PAP_RNA-bind CCDC53
Other DBs
NCBI-GeneID: 53344
NCBI-ProteinID: NP_001034929
OMIM: 300922
HGNC: 1934
Ensembl: ENSG00000204116
Pharos: Q5VXU3(Tdark)
UniProt: Q5VXU3
Position
X:73563148..73687111
AA seq 224 aa
MSILLPNMAEFDTISELEEEEEEEAATSSSSPSSSSSVSGPDDDEEDEEEEEEEEEEEEE
EEEEEEEEAPPPPRVVSEEHLRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAP
EEFKTSIGRVNACLKKALPVNVKWLLCGCLCCCCTLGCSLWPVICLNKRTRRSIQKLIEW
ENNRLYHKLALHWKLTKRKCETSNMMEYVILIEFLPKYPIFRPD
NT seq 675 nt   +upstreamnt  +downstreamnt
atgagcatcctgctgcccaacatggcggagttcgacaccatctcggaactggaggaggag
gaggaagaagaagcggcaacgtcgtcgtcgtcgccgtcgtcgtcgtcgtcggtatctggg
cccgacgatgacgaggaggatgaggaggaagaggaggaagaggaggaggaggaagaagag
gaggaggaggaagaggaggaggaagcgccgcccccgcctcgggtagtgagcgaggagcat
ctgcggagatatgctcccgaccctgtattagtgcggggtgccggccacatcactgtgttt
ggcttgagcaacaagtttgatactgaatttccctccgttctaacagggaaggtggcccca
gaagaatttaaaaccagcattggccgtgtgaatgcatgtttgaaaaaggctctcccggtc
aatgtgaaatggctgctgtgtggttgtctctgctgctgttgcacactgggttgcagccta
tggcctgttatttgtctcaacaaaagaaccagaagatcaattcagaagttaatagaatgg
gaaaataacagattatatcacaagcttgctttgcactggaagttgactaagaggaaatgt
gaaactagcaatatgatggagtatgtaatactaatagaattcttaccaaaatatcccata
ttccgacctgactga

DBGET integrated database retrieval system