KEGG   Homo sapiens (human): 53346Help
Entry
53346             CDS       T01001                                 

Gene name
TM6SF1
Definition
(RefSeq) transmembrane 6 superfamily member 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2781
Motif
Other DBs
NCBI-GeneID: 53346
NCBI-ProteinID: NP_075379
OMIM: 606562
HGNC: 11860
Ensembl: ENSG00000136404
Vega: OTTHUMG00000147365
Pharos: Q9BZW5(Tdark)
UniProt: Q9BZW5
Position
15q25.2
AA seq 370 aa AA seqDB search
MSASAATGVFVLSLSAIPVTYVFNHLAAQHDSWTIVGVAALILFLVALLARVLVKRKPPR
DPLFYVYAVFGFTSVVNLIIGLEQDGIIDGFMTHYLREGEPYLNTAYGHMICYWDGSAHY
LMYLVMVAAIAWEETYRTIGLYWVGSIIMSVVVFVPGNIVGKYGTRICPAFFLSIPYTCL
PVWAGFRIYNQPSENYNYPSKVIQEAQAKDLLRRPFDLMLVVCLLLATGFCLFRGLIALD
CPSELCRLYTQFQEPYLKDPAAYPKIQMLAYMFYSVPYFVTALYGLVVPGCSWMPDITLI
HAGGLAQAQFSHIGASLHARTAYVYRVPEEAKILFLALNIAYGVLPQLLAYRCIYKPEFF
IKTKAEEKVE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctctgcggccaccggggtcttcgtgctgtccctctcggccatcccggtcacc
tatgtcttcaaccacctggcggcccagcatgattcctggactattgtaggggttgctgcc
ctcatcctgttcctggtagcactgctggctcgtgtcctcgtcaaaagaaaaccaccccgg
gacccactgttctatgtgtatgcagtttttggatttaccagcgtggtgaacctcatcata
ggactggagcaagatggaatcattgacgggttcatgacacactacttgagagagggtgaa
ccgtatctgaacaccgcatatgggcacatgatctgctactgggatggctctgctcattat
ctgatgtacctggtgatggtggcagccatagcatgggaggaaacttatagaaccattggc
ctatattgggttggatctattattatgagtgttgttgtttttgtgccaggaaacattgta
gggaagtatggaacacgaatttgccctgcttttttcttaagcataccatatacttgtctt
cctgtctgggctggtttcagaatctataatcagccatcagaaaattataattacccctca
aaggttattcaagaagcccaagcgaaagacctgctgagaagaccatttgatttaatgttg
gttgtgtgtctcctcctggcaactggattttgcctgttcagaggtttgattgctttggat
tgcccatctgagctctgccgattatatacgcaatttcaagagccctatctaaaggatcct
gctgcttatcctaaaattcagatgctggcatatatgttctattctgttccttactttgtg
actgcactgtatggcttagtggttcctggatgttcctggatgcctgacatcacattgata
catgctggaggtctggctcaggctcagttttctcacattggtgcatctcttcatgctaga
actgcttatgtctacagagtccctgaagaagcaaaaatcctttttttagcattaaacata
gcatatggagttcttcctcagctcttggcctatcgttgtatctacaaaccagagttcttc
ataaaaacaaaggcagaagaaaaagtggaataa

DBGET integrated database retrieval system