KEGG   Homo sapiens (human): 53354Help
Entry
53354             CDS       T01001                                 

Gene name
PANK1, PANK
Definition
(RefSeq) pantothenate kinase 1
  KO
K09680  type II pantothenate kinase [EC:2.7.1.33]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00770  Pantothenate and CoA biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    53354 (PANK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     53354 (PANK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fumble
Motif
Other DBs
NCBI-GeneID: 53354
NCBI-ProteinID: NP_683878
OMIM: 606160
HGNC: 8598
Ensembl: ENSG00000152782
Vega: OTTHUMG00000018718
Pharos: Q8TE04(Tbio)
UniProt: Q8TE04
Structure
PDB: 

Position
10q23.31
AA seq 598 aa AA seqDB search
MLKLVGGGGGQDWACSVAGTSLGGEEAAFEVARPGDQGKAGGGSPGWGCAGIPDSAPGAG
VLQAGAVGPARGGQGAEEVGESAGGGEERRVRHPQAPALRLLNRKPQGGSGEIKTPENDL
QRGRLSRGPRTAPPAPGMGDRSGQQERSVPHSPGAPVGTSAAAVNGLLHNGFHPPPVQPP
HVCSRGPVGGSDAAPQRLPLLPELQPQPLLPQHDSPAKKCRLRRRMDSGRKNRPPFPWFG
MDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSNTAYGKTGIRDVHLELKNLTM
CGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHK
LDELDCLIQGLLYVDSVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVS
ILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTNVDKLVKDIYG
GDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENID
RVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactcgtcggtggcggtggcgggcaggactgggcatgctcagtggcggggacc
agtctgggaggcgaggaagccgcgtttgaagtcgcgcggcctggggatcaggggaaggcg
ggcggcgggagccccggctgggggtgcgcggggatccccgattccgcgcccggggctggc
gtgctccaggccggcgccgtggggccggcgcgcggggggcagggcgcagaggaggtgggg
gagtcggcaggaggaggggaggagcgccgggttcgccatccccaggcgccggctctgcgg
ctgctgaatcggaagccgcagggaggatccggggaaataaagacgccggagaatgacctc
cagcgaggccgcctgagccggggcccgcgcacagccccgccagcccccggcatgggcgac
cgcagcgggcagcaggagcgctcggtcccgcactctccaggggcccccgtgggcaccagc
gccgccgctgtgaacgggctgctgcacaacggcttccatccgccgccagtccagccgccg
cacgtctgcagccggggtccagtgggcggcagcgacgcggcgccccagcgcctcccgctc
ctgccggagctgcagccgcagccactgctccctcagcatgactccccggccaagaaatgc
cggctgcggaggaggatggactcggggagaaagaacaggccgccattcccatggtttggc
atggacatcggtggaacgctggttaaattggtgtatttcgagccgaaggatattacagcc
gaagaggagcaagaggaagtggagaacctgaagagcatccggaagtatttgacttctaat
actgcttatgggaaaactgggatccgagacgtccacctggaactgaaaaacctgaccatg
tgtggacgcaaagggaacctgcacttcatccgctttcccagctgtgctatgcacaggttc
attcagatgggcagcgagaagaacttctctagccttcacaccaccctctgtgccacagga
ggcggggctttcaaattcgaagaggacttcagaatgattgctgacctgcagctgcataaa
ctggatgaactggactgtctgattcagggcctgctttatgtcgactctgttggcttcaac
ggcaagccagaatgttactattttgaaaatcccacaaatcctgaattgtgtcaaaaaaag
ccgtactgccttgataacccataccctatgttgctggttaacatgggctcaggtgtcagc
attctagccgtgtactccaaggacaactataaaagagttacagggaccagtcttggaggt
ggaacattcctaggcctatgttgcttgctgactggttgtgagacctttgaagaagctctg
gaaatggcagctaaaggcgacagcaccaatgttgataaactggtgaaggacatttacgga
ggagactatgaacgatttggccttcaaggatctgctgtagcatcaagctttggcaacatg
atgagtaaagaaaagcgagattccatcagcaaggaagacctcgcccgggccacattggtc
accatcaccaacaacattggctccattgctcggatgtgcgcgttgaatgagaacatagac
agagttgtgtttgttggaaattttctcagaatcaatatggtctccatgaagctgctggca
tatgccatggatttttggtccaaaggacaactgaaagctctgtttttggaacatgagggt
tattttggagccgttggggcactgttggaactgttcaaaatgactgatgacaagtag

DBGET integrated database retrieval system