KEGG   Homo sapiens (human): 53373Help
Entry
53373             CDS       T01001                                 

Gene name
TPCN1, TPC1
Definition
(RefSeq) two pore segment channel 1
  KO
K16896  two pore calcium channel protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    53373 (TPCN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    53373 (TPCN1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Calcium channel, two-pore (TPC)
   53373 (TPCN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Pilin_N
Motif
Other DBs
NCBI-GeneID: 53373
NCBI-ProteinID: NP_060371
OMIM: 609666
HGNC: 18182
Ensembl: ENSG00000186815
Vega: OTTHUMG00000169625
Pharos: Q9ULQ1(Tbio)
UniProt: Q9ULQ1 B3KSG7
Position
12q24.13
AA seq 816 aa AA seqDB search
MAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSKNGGSYAIHDSQAPSLSSGGESSP
SSPAHNWEMNYQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL
LLSLCEAPAVPALRLGIYVHATLELFALMVVVFELCMKLRWLGLHTFIRHKRTMVKTSVL
VVQFVEAIVVLVRQMSHVRVTRALRCIFLVDCRYCGGVRRNLRQIFQSLPPFMDILLLLL
FFMIIFAILGFYLFSPNPSDPYFSTLENSIVSLFVLLTTANFPDVMMPSYSRNPWSCVFF
IVYLSIELYFIMNLLLAVVFDTFNDIEKRKFKSLLLHKRTAIQHAYRLLISQRRPAGISY
RQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNREHWF
DELPRTALLIFKGINILVKSKAFQYFMYLVVAVNGVWILVETFMLKGGNFFSKHVPWSYL
VFLTIYGVELFLKVAGLGPVEYLSSGWNLFDFSVTVFAFLGLLALALNMEPFYFIVVLRP
LQLLRLFKLKERYRNVLDTMFELLPRMASLGLTLLIFYYSFAIVGMEFFCGIVFPNCCNT
STVADAYRWRNHTVGNRTVVEEGYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQT
SHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYSRKNQDSEVDGGITLEKEISKEEL
VAVLELYREARGASSDVTRLLETLSQMERYQQHSMVFLGRRSRTKSDLSLKMYQEEIQEW
YEEHAREQEQQRQLSSSAAPAAQQPPGSRQRSQTVT
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgagtttggatgacgacgtgccgctcatcctgaccttggatgagggtggcagt
gccccactggctccctccaacggcctgggccaagaagagctacctagcaaaaatggcggc
agctatgccatccacgactcccaggcccccagtctcagctctgggggtgagagttccccc
tccagccccgcacacaactgggagatgaattaccaagaggcagcaatctacctccaggaa
ggcgagaacaacgacaagttcttcacccaccccaaggatgccaaggcgctggcggcctac
ctctttgcacacaatcacctcttctacctgatggagctggccacggccctgctgctgctg
ctgctctccctgtgcgaggcccccgccgtccccgcactccggcttggcatctatgtccac
gccaccctggagctgtttgccctgatggtggtagtgtttgaactctgcatgaagttacgc
tggctgggcctccacaccttcatccggcacaagcggaccatggtcaagacctcggtgctg
gtggtgcagtttgtcgaggccatcgtggtgttggtacggcagatgtcccatgtgcgggtg
acccgagcactgcgctgcattttcctggtggactgtcggtattgcggtggcgtccggcgc
aacctgcggcagatcttccagtccctgccgcccttcatggacatcctcctgctgctgctg
ttcttcatgatcatctttgccatcctcggtttctacttgttctcccctaacccttcagac
ccctacttcagcaccctggagaacagcatcgtcagtctgtttgtccttctgaccacagcc
aatttcccagatgtgatgatgccctcctactcccggaacccctggtcctgcgtcttcttc
atcgtgtacctctccatcgagctgtatttcatcatgaacctgcttctggctgtggtgttc
gacaccttcaatgacattgagaaacgcaagttcaagtctttgctactgcacaagcgaacc
gctatccagcatgcctaccgcctgctcatcagccagaggaggcctgccggcatctcctac
aggcagtttgaaggcctcatgcgcttctacaagccccggatgagtgccagggagcgctat
cttaccttcaaggccctgaatcagaacaacacacccctgctcagcctaaaggacttttac
gatatctacgaagttgctgctttgaagtggaaggccaagaaaaacagagagcactggttt
gatgagcttcccaggacggcgctcctcatcttcaaaggtattaatatccttgtgaagtcc
aaggccttccagtatttcatgtacttggtggtggcagtcaacggggtctggatcctcgtg
gagacatttatgctgaaaggtgggaacttcttctccaagcacgtgccctggagttacctc
gtctttctaactatctatggggtggagctgttcctgaaggttgccggcctgggccctgtg
gagtacttgtcttccggatggaacttgtttgacttctccgtgacagtgttcgccttcctg
ggactgctggcgctggccctcaacatggagcccttctatttcatcgtggtcctgcgcccc
ctccagctgctgaggttgtttaagttgaaggagcgctaccgcaacgtgctggacaccatg
ttcgagctgctgccccggatggccagcctgggcctcaccctgctcatcttttactactcc
ttcgccatcgtgggcatggagttcttctgcgggatcgtcttccccaactgctgcaacacg
agtacagtggcagatgcctaccgctggcgcaaccacaccgtgggcaacaggaccgtggtg
gaggaaggctactattatctcaataattttgacaacatcctcaacagctttgtgaccctg
tttgagctcacagttgtcaacaactggtacatcatcatggaaggcgtcacctctcagacc
tcccactggagccgcctctacttcatgaccttttacattgtgaccatggtggtgatgacg
atcattgtcgcctttatcctcgaggccttcgtcttccgaatgaactacagccgcaagaac
caggactcggaagttgatggtggcatcacccttgagaaggaaatctccaaagaagagctg
gttgccgtcctggagctctaccgggaggcacggggggcctcctcggatgtcaccaggctg
ctggagaccctctcccagatggagagataccagcaacattccatggtgtttctgggacgg
cgatcaaggaccaagagcgacctgagcctgaagatgtaccaggaggagatccaggagtgg
tatgaggagcatgccagggagcaagagcagcagcgacaactcagcagcagtgcagccccc
gccgcccagcagcccccaggcagccgccagcgctcccagaccgttacctag

DBGET integrated database retrieval system