KEGG   Homo sapiens (human): 5338Help
Entry
5338              CDS       T01001                                 

Gene name
PLD2, PLD1C
Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04912  GnRH signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    5338 (PLD2)
   00565 Ether lipid metabolism
    5338 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    5338 (PLD2)
   04072 Phospholipase D signaling pathway
    5338 (PLD2)
   04071 Sphingolipid signaling pathway
    5338 (PLD2)
   04024 cAMP signaling pathway
    5338 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    5338 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    5338 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5338 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    5338 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    5338 (PLD2)
 09160 Human Diseases
  09161 Cancers
   05231 Choline metabolism in cancer
    5338 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5338 (PLD2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     5338 (PLD2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    5338 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    5338 (PLD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Motif
Other DBs
NCBI-GeneID: 5338
NCBI-ProteinID: NP_002654
OMIM: 602384
HGNC: 9068
Ensembl: ENSG00000129219
Vega: OTTHUMG00000090779
Pharos: O14939(Tchem)
UniProt: O14939
Position
17p13.2
AA seq 933 aa AA seqDB search
MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFA
PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVL
MSLLPLARFAVAYSPARDAGNREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYR
NYHAMTEFLEVSQLSFIPDLGRKGLEGMIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARHGVRIDTSHRSLILKCSSYRQAR
WWAQEITELAQGPGRDFLQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIF
ITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRAL
MLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSE
SAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPW
RDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPTYPYLLPKSTSTANQLPFTLPGGQ
CTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGWCYRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKVLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFGVILGANTRPDLDLRDPICD
DFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQ
GHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgacccctgagagcctcttccccactggggacgaactggactccagccagctc
cagatggagtccgatgaggtggacaccctgaaggagggagaggacccagccgaccggatg
cacccgtttctggccatctatgagcttcagtctctgaaagtgcaccccttggtgttcgca
cctggggtccctgtcacagcccaggtggtgggcaccgaaagatataccagcggatccaag
gtgggaacctgcactctgtattctgtccgcttgactcacggcgacttttcctggacaacc
aagaagaaataccgtcattttcaggagctgcatcgggacctcctgagacacaaagtcttg
atgagtctgctccctctggctcgatttgccgttgcctattctccagcccgagatgcaggc
aacagagagatgccctctctaccccgggcaggtcctgagggctccaccagacatgcagcc
agcaaacagaaatacctggagaattacctcaaccgtctcttgaccatgtctttctatcgc
aactaccatgccatgacagagttcctggaagtcagtcagctgtcctttatcccggacttg
ggccgcaaaggactggaggggatgatccggaagcgctcaggtggccaccgtgttcctggc
ctcacctgctgtggccgagaccaagtttgttatcgctggtccaagaggtggctggtggtg
aaggactccttcctgctgtacatgtgcctcgagacaggtgccatctcatttgttcagctc
tttgaccctggctttgaggtgcaagtggggaaaaggagcacggaggcacggcacggcgtg
cggatcgatacctcccacaggtccttgattctcaagtgcagcagctaccggcaggcacgg
tggtgggcccaagagatcactgagctggcacagggcccaggcagagacttcctacagctg
caccggcatgacagctacgccccaccccggcctgggaccttggcccggtggtttgtgaat
ggggcaggttactttgctgctgtggcagatgccatccttcgagctcaagaggagattttc
atcacagactggtggttgagtcctgaggtttacctgaagcgtccggcccattcagatgac
tggagactggacattatgctcaagaggaaggcggaggagggtgtccgtgtgtctattctg
ctgtttaaagaagtggaattggccttgggcatcaacagtggctatagcaagagggcgctg
atgctgctgcaccccaacataaaggtgatgcgtcacccagaccaagtgacgttgtgggcc
catcatgagaagctcctggtggtggaccaagtggtagcattcctggggggactggacctt
gcctatggccgctgggatgacctgcactaccgactgactgaccttggagactcctctgaa
tcagctgcctcccagcctcccaccccgcgcccagactcaccagccaccccagacctctct
cacaaccaattcttctggctgggcaaggactacagcaatcttatcaccaaggactgggtg
cagctggaccggcctttcgaagatttcattgacagggagacgacccctcggatgccatgg
cgggacgttggggtggtcgtccatggcctaccggcccgggaccttgcccggcacttcatc
cagcgctggaacttcaccaagaccaccaaggccaagtacaagactcccacatacccctac
ctgcttcccaagtctaccagcacggccaatcagctccccttcacacttccaggagggcag
tgcaccaccgtacaggtcttgcgatcagtggaccgctggtcagcagggactctggagaac
tccatcctcaatgcctacctgcacaccatcagggagagccagcacttcctctacattgag
aatcagttcttcattagctgctcagatgggcggacggttctgaacaaggtgggcgatgag
attgtggacagaatcctgaaggcccacaaacaggggtggtgttaccgagtctacgtgctt
ttgcccttactccctggcttcgagggtgacatctccacgggcggtggcaactccatccag
gccattctgcactttacttacaggaccctgtgtcgtggggagtattcaatcctgcatcgc
cttaaagcagccatggggacagcatggcgggactatatttccatctgcgggcttcgtaca
cacggagagctgggcgggcaccccgtctcggagctcatctacatccacagcaaggtgctc
atcgcagatgaccggacagtcatcattggttctgcaaacatcaatgaccggagcttgctg
gggaagcgggacagtgagctggccgtgctgatcgaggacacagagacggaaccatccctc
atgaatggggcagagtatcaggcgggcaggtttgccttgagtctgcggaagcactgcttc
ggtgtgattcttggagcaaatacccggccagacttggatctccgagaccccatctgtgat
gacttcttccagttgtggcaagacatggctgagagcaacgccaatatctatgagcagatc
ttccgctgcctgccatccaatgccacgcgttccctgcggactctccgggagtacgtggcc
gtggagcccttggccacggtcagtccccccttggctcggtctgagctcacccaggtccag
ggccacctggtccacttccccctcaagttcctagaggatgagtctttgctgcccccgctg
ggtagcaaggagggcatgatccccctagaagtgtggacatag

DBGET integrated database retrieval system