KEGG   Homo sapiens (human): 534Help
Entry
534               CDS       T01001                                 

Gene name
ATP6V1G2, ATP6G, ATP6G2, NG38, VMA10
Definition
(RefSeq) ATPase H+ transporting V1 subunit G2
  KO
K02152  V-type H+-transporting ATPase subunit G
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04145  Phagosome
hsa04150  mTOR signaling pathway
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    534 (ATP6V1G2)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    534 (ATP6V1G2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    534 (ATP6V1G2)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    534 (ATP6V1G2)
  Nervous system
   04721 Synaptic vesicle cycle
    534 (ATP6V1G2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    534 (ATP6V1G2)
  Infectious diseases
   05110 Vibrio cholerae infection
    534 (ATP6V1G2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    534 (ATP6V1G2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-ATPase_G Zein-binding
Motif
Other DBs
NCBI-GeneID: 534
NCBI-ProteinID: NP_569730
OMIM: 606853
HGNC: 862
Ensembl: ENSG00000213760
Vega: OTTHUMG00000166618
Pharos: O95670(Tdark)
UniProt: O95670 Q6NVJ2
Position
6p21.33
AA seq 118 aa AA seqDB search
MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQ
AAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggccagtcagtcccaaggtatccagcagcttctgcaagctgagaagcgggcagctgag
aaggtggcagatgccagaaagaggaaggcccggcgactgaagcaggcaaaggaggaggca
cagatggaggtggagcaataccgcagagagcgagagcacgaattccagagcaagcagcag
gcggccatgggctcccaggggaacctgtctgctgaggtggagcaggctacaaggcgccag
gtgcagggcatgcagagctcccagcagagaaaccgagagcgtgtcctggcccagcttctt
ggcatggtctgcgacgtcaggccccaggtccaccccaactaccggatttctgcctag

DBGET integrated database retrieval system