KEGG   Homo sapiens (human): 5340Help
Entry
5340              CDS       T01001                                 

Gene name
PLG
Definition
(RefSeq) plasminogen
  KO
K01315  plasminogen [EC:3.4.21.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
hsa05164  Influenza A
Disease
H00223  Inherited thrombophilia
H01206  Plasminogen deficiency
Drug target
Aminocaproic acid: D00160
Aminomethylbenzoic acid: D07568
Tranexamic acid: D01136
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5340 (PLG)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    5340 (PLG)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    5340 (PLG)
  09172 Infectious diseases: Viral
   05164 Influenza A
    5340 (PLG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    5340 (PLG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5340 (PLG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.7  plasmin
     5340 (PLG)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   5340 (PLG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5340 (PLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kringle Trypsin PAN_1 Trypsin_2 DUF1986 DUF3719
Motif
Other DBs
NCBI-GeneID: 5340
NCBI-ProteinID: NP_000292
OMIM: 173350
HGNC: 9071
Ensembl: ENSG00000122194
Vega: OTTHUMG00000015957
Pharos: P00747(Tclin)
UniProt: P00747
Structure
PDB: 

Position
6q26
AA seq 810 aa AA seqDB search
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggaacataaggaagtggttcttctacttcttttatttctgaaatcaggtcaaggagag
cctctggatgactatgtgaatacccagggggcttcactgttcagtgtcactaagaagcag
ctgggagcaggaagtatagaagaatgtgcagcaaaatgtgaggaggacgaagaattcacc
tgcagggcattccaatatcacagtaaagagcaacaatgtgtgataatggctgaaaacagg
aagtcctccataatcattaggatgagagatgtagttttatttgaaaagaaagtgtatctc
tcagagtgcaagactgggaatggaaagaactacagagggacgatgtccaaaacaaaaaat
ggcatcacctgtcaaaaatggagttccacttctccccacagacctagattctcacctgct
acacacccctcagagggactggaggagaactactgcaggaatccagacaacgatccgcag
gggccctggtgctatactactgatccagaaaagagatatgactactgcgacattcttgag
tgtgaagaggaatgtatgcattgcagtggagaaaactatgacggcaaaatttccaagacc
atgtctggactggaatgccaggcctgggactctcagagcccacacgctcatggatacatt
ccttccaaatttccaaacaagaacctgaagaagaattactgtcgtaaccccgatagggag
ctgcggccttggtgtttcaccaccgaccccaacaagcgctgggaactttgtgacatcccc
cgctgcacaacacctccaccatcttctggtcccacctaccagtgtctgaagggaacaggt
gaaaactatcgcgggaatgtggctgttaccgtgtccgggcacacctgtcagcactggagt
gcacagacccctcacacacataacaggacaccagaaaacttcccctgcaaaaatttggat
gaaaactactgccgcaatcctgacggaaaaagggccccatggtgccatacaaccaacagc
caagtgcggtgggagtactgtaagataccgtcctgtgactcctccccagtatccacggaa
caattggctcccacagcaccacctgagctaacccctgtggtccaggactgctaccatggt
gatggacagagctaccgaggcacatcctccaccaccaccacaggaaagaagtgtcagtct
tggtcatctatgacaccacaccggcaccagaagaccccagaaaactacccaaatgctggc
ctgacaatgaactactgcaggaatccagatgccgataaaggcccctggtgttttaccaca
gaccccagcgtcaggtgggagtactgcaacctgaaaaaatgctcaggaacagaagcgagt
gttgtagcacctccgcctgttgtcctgcttccagatgtagagactccttccgaagaagac
tgtatgtttgggaatgggaaaggataccgaggcaagagggcgaccactgttactgggacg
ccatgccaggactgggctgcccaggagccccatagacacagcattttcactccagagaca
aatccacgggcgggtctggaaaaaaattactgccgtaaccctgatggtgatgtaggtggt
ccctggtgctacacgacaaatccaagaaaactttacgactactgtgatgtccctcagtgt
gcggccccttcatttgattgtgggaagcctcaagtggagccgaagaaatgtcctggaagg
gttgtaggggggtgtgtggcccacccacattcctggccctggcaagtcagtcttagaaca
aggtttggaatgcacttctgtggaggcaccttgatatccccagagtgggtgttgactgct
gcccactgcttggagaagtccccaaggccttcatcctacaaggtcatcctgggtgcacac
caagaagtgaatctcgaaccgcatgttcaggaaatagaagtgtctaggctgttcttggag
cccacacgaaaagatattgccttgctaaagctaagcagtcctgccgtcatcactgacaaa
gtaatcccagcttgtctgccatccccaaattatgtggtcgctgaccggaccgaatgtttc
atcactggctggggagaaacccaaggtacttttggagctggccttctcaaggaagcccag
ctccctgtgattgagaataaagtgtgcaatcgctatgagtttctgaatggaagagtccaa
tccaccgaactctgtgctgggcatttggccggaggcactgacagttgccagggtgacagt
ggaggtcctctggtttgcttcgagaaggacaaatacattttacaaggagtcacttcttgg
ggtcttggctgtgcacgccccaataagcctggtgtctatgttcgtgtttcaaggtttgtt
acttggattgagggagtgatgagaaataattaa

DBGET integrated database retrieval system