KEGG   Homo sapiens (human): 53407Help
Entry
53407             CDS       T01001                                 

Gene name
STX18, Ufe1
Definition
(RefSeq) syntaxin 18
  KO
K08492  syntaxin 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
hsa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    53407 (STX18)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    53407 (STX18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    53407 (STX18)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-rER
    53407 (STX18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin-18_N Phage_Integr_2 TipAS DUF913
Motif
Other DBs
NCBI-GeneID: 53407
NCBI-ProteinID: NP_058626
OMIM: 606046
HGNC: 15942
Ensembl: ENSG00000168818
Vega: OTTHUMG00000090331
Pharos: Q9P2W9(Tbio)
UniProt: Q9P2W9
Position
4p16.3-p16.2
AA seq 335 aa AA seqDB search
MAVDITLLFRASVKTVKTRNKALGVAVGGGVDGSRDELFRRSPRPKGDFSSRAREVISHI
GKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQIFMRTCSEAIQQLRTEAHK
EIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRES
TSSEKVSQSPSKDSEENPATEERPEKILAETQPELGTWGDGKGEDELSPEEIQMFEQENQ
RLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIKEGNE
DIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYDS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggacatcacgctgctattccgggccagcgtcaagaccgtgaagacgcggaac
aaggcgctgggagtggcggtgggcggcggggtcgatggcagccgggacgagctgttccgc
cggagcccccggcccaagggcgacttctccagccgggcccgcgaagtgatttctcacatt
ggcaaactgagagattttcttctggaacacaggaaagattatattaatgcttatagccat
accatgtctgaatatgggaggatgacagacacagaacgagaccagatagaccaggatgcc
cagatattcatgaggacctgttcagaagcaattcagcaactacgaacagaagctcacaag
gagatacattcccagcaagtgaaggagcacaggaccgctgttttggatttcattgaagat
tacttgaaaagagtatgtaaactttactcagaacagagagccatccgagttaaaagagtg
gtggataagaaaagattatctaagctggaaccagaaccaaatacaaagacaagagaatcc
acatcttctgagaaagtttcacagagtccttcaaaagactctgaagaaaaccctgccact
gaagaacgtccagaaaaaattttggctgaaacacaacctgaattgggaacgtggggagat
ggcaaaggcgaagatgagttatccccagaagaaatacaaatgtttgaacaggaaaatcag
cgactaattggtgaaatgaacagcttgtttgatgaagtgaggcaaatcgaagggagagtg
gttgagatttccagactccaagagatattcacggaaaaggttttgcaacaggaagctgag
attgacagcattcaccagttagttgtgggggcaactgaaaatatcaaggaaggcaacgaa
gacataagagaggccattaaaaacaacgctggcttccgcgtgtggatcctcttcttcctc
gtgatgtgctccttctccttgctcttcctcgactggtacgacagctag

DBGET integrated database retrieval system