KEGG   Homo sapiens (human): 5343Help
Entry
5343              CDS       T01001                                 

Gene name
PLGLB1, PLGL, PLGP1, PRGB, PRP-B
Definition
(RefSeq) plasminogen-like B1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PAN_1 PAN_4 PAN_2
Motif
Other DBs
NCBI-GeneID: 5343
NCBI-ProteinID: NP_001027564
OMIM: 173340
HGNC: 9072
Ensembl: ENSG00000183281
Vega: OTTHUMG00000154612
Pharos: Q02325(Tdark)
UniProt: Q02325
Position
2p11.2
AA seq 96 aa AA seqDB search
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggaacataaggaagtggttcttctacttcttttatttctgaaatcaggtcaaggagag
cccctggatgactatgtgaatacccaggggccttcactgttcagtgtcactaagaagcag
ctgggggcaggaagcagagaagaatgtgcagcaaaatgtgaagaggacaaagaattcacc
tgcagggcattccaatatcacagtaaagagcaacaatgtgtgataatggctgaaaacagg
aagtcctccataatcattaggatgagagatgcagttttatttgaaaagtaa

DBGET integrated database retrieval system