KEGG   Homo sapiens (human): 5346
Entry
5346              CDS       T01001                                 

Gene name
PLIN1, FPLD4, PERI, PLIN
Definition
(RefSeq) perilipin 1
  KO
K08768  perilipin-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04371  Apelin signaling pathway
hsa04714  Thermogenesis
hsa04923  Regulation of lipolysis in adipocytes
Disease
H00420  Familial partial lipodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5346 (PLIN1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    5346 (PLIN1)
   03320 PPAR signaling pathway
    5346 (PLIN1)
  09159 Environmental adaptation
   04714 Thermogenesis
    5346 (PLIN1)
SSDB
Motif
Pfam: Perilipin TfoX_C
Other DBs
NCBI-GeneID: 5346
NCBI-ProteinID: NP_001138783
OMIM: 170290
HGNC: 9076
Ensembl: ENSG00000166819
Vega: OTTHUMG00000149813
Pharos: O60240(Tbio)
UniProt: O60240
Position
15q26.1
AA seq 522 aa
MAVNKGLTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEK
GVQSASSLAAWSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTI
STRLRSARNSISVPIASTSDKVLGAALAGCELAWGVARDTAEFAANTRAGRLASGGADLA
LGSIEKVVEYLLPPDKEESAPAPGHQQAQKSPKAKPSLLSRVGALTNTLSRYTVQTMARA
LEQGHTVAMWIPGVVPLSSLAQWGASVAMQAVSRRRSEVRVPWLHSLAAAQEEDHEDQTD
TEGEDTEEEEELETEENKFSEVAALPGPRGLLGGVAHTLQKTLQTTISAVTWAPAAVLGM
AGRVLHLTPAPAVSSTKGRAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFRDID
NPPAEVERREAERRASGAPSAGPEPAPRLAQPRRSLRSAQSPGAPPGPGLEDEVATPAAP
RPGFPAVPREKPKRRVSDSFFRPSVMEPILGRTHYSQLRKKS
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggcagtcaacaaaggcctcaccttgctggatggagacctccctgagcaggagaatgtg
ctgcagcgggtcctgcagctgccggtggtgagtggcacctgcgaatgcttccagaagacc
tacaccagcactaaggaagcccaccccctggtggcctctgtgtgcaatgcctatgagaag
ggcgtgcagagcgccagtagcttggctgcctggagcatggagccggtggtccgcaggctg
tccacccagttcacagctgccaatgagctggcctgccgaggcttggaccacctggaggaa
aagatccccgccctccagtacccccctgaaaagattgcttctgagctgaaggacaccatc
tccacccgcctccgcagtgccagaaacagcatcagcgttcccatcgcgagcacttcagac
aaggtcctgggggccgctttggccgggtgcgagcttgcctggggggtggccagagacact
gcggaatttgctgccaacactcgagctggccgactggcttctggaggggccgacttggcc
ttgggcagcattgagaaggtggtggagtacctcctccctccagacaaggaagagtcagcc
cctgctcctggacaccagcaagcccagaagtctcccaaggccaagccaagcctcttgagc
agggttggggctctgaccaacaccctctctcgatacaccgtgcagaccatggcccgggcc
ctggagcagggccacaccgtggccatgtggatcccaggcgtggtgcccctgagcagcctg
gcccagtggggtgcctcagtggccatgcaggcggtgtcccggcggaggagcgaagtgcgg
gtaccctggctgcacagcctcgcagccgcccaggaggaggatcatgaggaccagacagac
acggagggagaggacacggaggaggaggaagaattggagactgaggagaacaagttcagt
gaggtagcagccctgccaggccctcgaggcctcctgggtggtgtggcacataccctgcag
aagaccctccagaccaccatctcggctgtgacatgggcacctgcagctgtgctgggcatg
gcagggagggtgctgcacctcacaccagcccctgctgtctcctcaaccaaggggagggcc
atgtccctatcagatgccctgaagggcgttactgacaacgtggtggacacagtggtgcat
tacgtgccgctccccaggctgtcgctgatggagcccgagagcgaattccgggacatcgac
aacccaccagccgaggtcgagcgccgggaggcggagcgcagagcgtctggggcgccgtcc
gccggcccggagcccgccccgcgtctcgcacagccccgccgcagcctgcgcagcgcgcag
agccccggcgcgccccccggcccgggcctggaggacgaagtcgccacgcccgcagcgccg
cgcccgggcttcccggccgtgccccgcgagaagccaaagcgcagggtcagcgacagcttc
ttccggcccagcgtcatggagcccatcctgggccgcacgcattacagccagctgcgcaag
aagagctga

DBGET integrated database retrieval system