KEGG   Homo sapiens (human): 5347Help
Entry
5347              CDS       T01001                                 

Gene name
PLK1, PLK, STPK13
Definition
(RefSeq) polo like kinase 1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Drug target
Rigosertib (DG01416): D10154 D10155
Volasertib (DG01417): D10182 D10183
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    5347 (PLK1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    5347 (PLK1)
   04114 Oocyte meiosis
    5347 (PLK1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    5347 (PLK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     5347 (PLK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   5347 (PLK1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     5347 (PLK1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    5347 (PLK1)
  Sister chromatid separation proteins
   Polo kinases
    5347 (PLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase POLO_box Pkinase_Tyr Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 5347
NCBI-ProteinID: NP_005021
OMIM: 602098
HGNC: 9077
Ensembl: ENSG00000166851
Vega: OTTHUMG00000096984
Pharos: P53350(Tchem)
UniProt: P53350
Structure
PDB: 

Position
16p12.2
AA seq 603 aa AA seqDB search
MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLG
KGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFF
EDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLG
NLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI
MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL
NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEE
PVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLK
YFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTK
LILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL
KAS
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgcagtgactgcagggaagctggcacgggcaccggccgaccctgggaaagcc
ggggtccccggagttgcagctcccggagctccggcggcggctccaccggcgaaagagatc
ccggaggtcctagtggacccacgcagccggcggcgctatgtgcggggccgctttttgggc
aagggcggctttgccaagtgcttcgagatctcggacgcggacaccaaggaggtgttcgcg
ggcaagattgtgcctaagtctctgctgctcaagccgcaccagagggagaagatgtccatg
gaaatatccattcaccgcagcctcgcccaccagcacgtcgtaggattccacggctttttc
gaggacaacgacttcgtgttcgtggtgttggagctctgccgccggaggtctctcctggag
ctgcacaagaggaggaaagccctgactgagcctgaggcccgatactacctacggcaaatt
gtgcttggctgccagtacctgcaccgaaaccgagttattcatcgagacctcaagctgggc
aaccttttcctgaatgaagatctggaggtgaaaataggggattttggactggcaaccaaa
gtcgaatatgacggggagaggaagaagaccctgtgtgggactcctaattacatagctccc
gaggtgctgagcaagaaagggcacagtttcgaggtggatgtgtggtccattgggtgtatc
atgtataccttgttagtgggcaaaccaccttttgagacttcttgcctaaaagagacctac
ctccggatcaagaagaatgaatacagtattcccaagcacatcaaccccgtggccgcctcc
ctcatccagaagatgcttcagacagatcccactgcccgcccaaccattaacgagctgctt
aatgacgagttctttacttctggctatatccctgcccgtctccccatcacctgcctgacc
attccaccaaggttttcgattgctcccagcagcctggaccccagcaaccggaagcccctc
acagtcctcaataaaggcttggagaaccccctgcctgagcgtccccgggaaaaagaagaa
ccagtggttcgagagacaggtgaggtggtcgactgccacctcagtgacatgctgcagcag
ctgcacagtgtcaatgcctccaagccctcggagcgtgggctggtcaggcaagaggaggct
gaggatcctgcctgcatccccatcttctgggtcagcaagtgggtggactattcggacaag
tacggccttgggtatcagctctgtgataacagcgtgggggtgctcttcaatgactcaaca
cgcctcatcctctacaatgatggtgacagcctgcagtacatagagcgtgacggcactgag
tcctacctcaccgtgagttcccatcccaactccttgatgaagaagatcaccctccttaaa
tatttccgcaattacatgagcgagcacttgctgaaggcaggtgccaacatcacgccgcgc
gaaggtgatgagctcgcccggctgccctacctacggacctggttccgcacccgcagcgcc
atcatcctgcacctcagcaacggcagcgtgcagatcaacttcttccaggatcacaccaag
ctcatcttgtgcccactgatggcagccgtgacctacatcgacgagaagcgggacttccgc
acataccgcctgagtctcctggaggagtacggctgctgcaaggagctggccagccggctc
cgctacgcccgcactatggtggacaagctgctgagctcacgctcggccagcaaccgtctc
aaggcctcctaa

DBGET integrated database retrieval system