KEGG   Homo sapiens (human): 5348Help
Entry
5348              CDS       T01001                                 

Gene name
FXYD1, PLM
Definition
(RefSeq) FXYD domain containing ion transport regulator 1
  KO
K13360  FXYD domain-containing ion transport regulator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5348 (FXYD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5348 (FXYD1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    5348 (FXYD1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   FXYD proteins
    5348 (FXYD1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   5348 (FXYD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP1G1_PLM_MAT8 EphA2_TM DUF4668 Nitrate_red_gam
Motif
Other DBs
NCBI-GeneID: 5348
NCBI-ProteinID: NP_001265646
OMIM: 602359
HGNC: 4025
Ensembl: ENSG00000266964
Vega: OTTHUMG00000182359
Pharos: O00168(Tbio)
UniProt: O00168
Structure
PDB: 

Position
19q13.12
AA seq 92 aa AA seqDB search
MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRC
RCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcttggccacatcttggttttctgtgtgggtctcctcaccatggccaaggca
gaaagtccaaaggaacacgacccgttcacttacgactaccagtccctgcagatcggaggc
ctcgtcatcgccgggatcctcttcatcctgggcatcctcatcgtgctgagcagaagatgc
cggtgcaagttcaaccagcagcagaggactggggaacccgatgaagaggagggaactttc
cgcagctccatccgccgtctgtccacccgcaggcggtag

DBGET integrated database retrieval system