KEGG   Homo sapiens (human): 5352Help
Entry
5352              CDS       T01001                                 

Gene name
PLOD2, BRKS2, LH2, TLH
Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
  KO
K13645  procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 [EC:1.14.11.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
Disease
H00514  Bruck syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    5352 (PLOD2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     5352 (PLOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy Anp1 2OG-FeII_Oxy_3 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 5352
NCBI-ProteinID: NP_000926
OMIM: 601865
HGNC: 9082
Ensembl: ENSG00000152952
Vega: OTTHUMG00000159417
Pharos: O00469(Tbio)
UniProt: O00469
Position
3q24
AA seq 737 aa AA seqDB search
MGGCTVKPQLLLLALVLHPWNPCLGADSEKPSSIPTDKLLVITVATKESDGFHRFMQSAK
YFNYTVKVLGQGEEWRGGDGINSIGGGQKVRLMKEVMEHYADQDDLVVMFTECFDVIFAG
GPEEVLKKFQKANHKVVFAADGILWPDKRLADKYPVVHIGKRYLNSGGFIGYAPYVNRIV
QQWNLQDNDDDQLFYTKVYIDPLKREAINITLDHKCKIFQTLNGAVDEVVLKFENGKARA
KNTFYETLPVAINGNGPTKILLNYFGNYVPNSWTQDNGCTLCEFDTVDLSAVDVHPNVSI
GVFIEQPTPFLPRFLDILLTLDYPKEALKLFIHNKEVYHEKDIKVFFDKAKHEIKTIKIV
GPEENLSQAEARNMGMDFCRQDEKCDYYFSVDADVVLTNPRTLKILIEQNRKIIAPLVTR
HGKLWSNFWGALSPDGYYARSEDYVDIVQGNRVGVWNVPYMANVYLIKGKTLRSEMNERN
YFVRDKLDPDMALCRNAREMGVFMYISNRHEFGRLLSTANYNTSHYNNDLWQIFENPVDW
KEKYINRDYSKIFTENIVEQPCPDVFWFPIFSEKACDELVEEMEHYGKWSGGKHHDSRIS
GGYENVPTDDIHMKQVDLENVWLHFIREFIAPVTLKVFAGYYTKGFALLNFVVKYSPERQ
RSLRPHHDASTFTINIALNNVGEDFQGGGCKFLRYNCSIESPRKGWSFMHPGRLTHLHEG
LPVKNGTRYIAVSFIDP
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggggggatgcacggtgaagcctcagctgctgctcctggcgctcgtcctccacccctgg
aatccctgtctgggtgcggactcggagaagccctcgagcatccccacagataaattatta
gtcataactgtagcaacaaaagaaagtgatggattccatcgatttatgcagtcagccaaa
tatttcaattatactgtgaaggtccttggtcaaggagaagaatggagaggtggtgatgga
attaatagtattggagggggccagaaagtgagattaatgaaagaagtcatggaacactat
gctgatcaagatgatctggttgtcatgtttactgaatgctttgatgtcatatttgctggt
ggtccagaagaagttctaaaaaaattccaaaaggcaaaccacaaagtggtctttgcagca
gatggaattttgtggccagataaaagactagcagacaagtatcctgttgtgcacattggg
aaacgctatctgaattcaggaggatttattggctatgctccatatgtcaaccgtatagtt
caacaatggaatctccaggataatgatgatgatcagctcttttacactaaagtttacatt
gatccactgaaaagggaagctattaacatcacattggatcacaaatgcaaaattttccag
accttaaatggagctgtagatgaagttgttttaaaatttgaaaatggcaaagccagagct
aagaatacattttatgaaacattaccagtggcaattaatggaaatggacccaccaagatt
ctcctgaattattttggaaactatgtacccaattcatggacacaggataatggctgcact
ctttgtgaattcgatacagtcgacttgtctgcagtagatgtccatccaaacgtatcaata
ggtgtttttattgagcaaccaaccccttttctacctcggtttctggacatattgttgaca
ctggattacccaaaagaagcacttaaactttttattcataacaaagaagtttatcatgaa
aaggacatcaaggtattttttgataaagctaagcatgaaatcaaaactataaaaatagta
ggaccagaagaaaatctaagtcaagcggaagccagaaacatgggaatggacttttgccgt
caggatgaaaagtgtgattattactttagtgtggatgcagatgttgttttgacaaatcca
aggactttaaaaattttgattgaacaaaacagaaagatcattgctcctcttgtaactcgt
catggaaagctgtggtccaatttctggggagcattgagtcctgatggatactatgcacga
tctgaagattatgtggatattgttcaagggaatagagtaggagtatggaatgtcccatat
atggctaatgtgtacttaattaaaggaaagacactccgatcagagatgaatgaaaggaac
tattttgttcgtgataaactggatcctgatatggctctttgccgaaatgctagagaaatg
ggtgtatttatgtacatttctaatagacatgaatttggaaggctattatccactgctaat
tacaatacttcccattataacaatgacctctggcagatttttgaaaatcctgtggactgg
aaggaaaagtatataaaccgtgattattcaaagattttcactgaaaatatagttgaacag
ccctgtccagatgtcttttggttccccatattttctgaaaaagcctgtgatgaattggta
gaagaaatggaacattacggcaaatggtctgggggaaaacatcatgatagccgtatatct
ggtggttatgaaaatgtcccaactgatgatatccacatgaagcaagttgatctggagaat
gtatggcttcattttatccgggagttcattgcaccagttacactgaaggtctttgcaggc
tattatacgaagggatttgcactactgaattttgtagtaaaatactcccctgaacgacag
cgttctcttcgtcctcatcatgatgcttctacatttaccataaacattgcacttaataac
gtgggagaagactttcagggaggtggttgcaaatttctaaggtacaattgctctattgag
tcaccacgaaaaggctggagcttcatgcatcctgggagactcacacatttgcatgaagga
cttcctgttaaaaatggaacaagatacattgcagtgtcatttatagatccctaa

DBGET integrated database retrieval system