KEGG   Homo sapiens (human): 5356Help
Entry
5356              CDS       T01001                                 

Gene name
PLRG1, Cwc1, PRL1, PRP46, PRPF46, TANGO4
Definition
(RefSeq) pleiotropic regulator 1
  KO
K12862  pleiotropic regulator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    5356 (PLRG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    5356 (PLRG1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5356 (PLRG1)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    5356 (PLRG1)
 Complex C
   Prp19-CDC5 complex
    5356 (PLRG1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   PSO4 complex
    5356 (PLRG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nucleoporin_N Nup160 W_rich_C
Motif
Other DBs
NCBI-GeneID: 5356
NCBI-ProteinID: NP_002660
OMIM: 605961
HGNC: 9089
Ensembl: ENSG00000171566
Vega: OTTHUMG00000161411
Pharos: O43660(Tbio)
UniProt: O43660
Structure
PDB: 

Position
4q31.3
AA seq 514 aa AA seqDB search
MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPT
SKENLKEKGPQNATDSYVHKQYPANQGQEVEYFVAGTHPYPPGPGVALTADTKIQRMPSE
SAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAK
KAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKL
SLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTI
DVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLV
AGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPDNIKQWKFPDGSFIQNLSGHNAIINTLT
VNSDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDQSESRLLTA
EADKTIKVYREDDTATEETHPVSWKPEIIKRKRF
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaggaggtacagaaacattctgtacacacccttgtgttcaggtcgttgaagagg
acccatgacatgtttgtagctgataatggaaaacctgtgcctttagatgaagagagtcac
aaacgaaaaatggcaatcaagcttcgtaatgagtatggtcctgtgttgcatatgcctact
tcaaaagaaaatcttaaagagaagggtcctcagaatgcaacggattcatatgttcataaa
cagtaccctgccaatcaaggacaagaagttgaatactttgtggcaggtacacatccatac
ccaccaggacctggggttgctttgacagcagatactaagatccagagaatgccaagtgaa
tcagctgcacagtccttagcggtggcattacctttgcagaccaaggctgatgcaaatcgt
actgcccctagtggaagtgaataccgacatcctggggcttctgaccgtccacagcctaca
gcgatgaattcaattgtcatggagactggcaataccaagaactctgcactgatggctaaa
aaagcccctacaatgccaaaaccccagtggcacccaccgtggaaactctacagggttatc
agtgggcatcttggctgggttcgatgtattgctgtggaacctggaaatcagtggtttgtt
actggatctgctgacagaactataaagatctgggacttggctagtggcaaattaaaactg
tcattgactgggcatattagtactgtgcggggcgtgatagtaagcacaaggagcccatat
ctgttctcttgtggagaagacaaacaagtgaaatgctgggatctcgaatacaataaggtt
atacggcattatcatggacatttaagtgcagtgtatggtttggatttgcacccgacaatc
gatgtgttggtaacctgtagtcgagattcaactgcacggatttgggatgtgagaactaaa
gccagtgtacacacattatctggacatacaaatgcagttgctacagtgagatgtcaggct
gcagaaccacaaattattacaggaagccatgatactacaattcgattatgggatctggtg
gctggaaaaacaagagtgacattaacaaatcacaaaaaatcagttagggctgtggtttta
catccaagacattacacatttgcatctggttctccagataacataaagcagtggaaattc
cctgatggaagtttcattcaaaatctttccggtcataatgctattattaacacattgacg
gtaaattctgatggagtgcttgtatctggagctgacaatggcaccatgcatctttgggac
tggagaactggctacaattttcagagagttcacgcagctgtgcaacctgggtctttggac
agtgaatcaggaatatttgcttgtgcttttgatcagtctgaaagtcgattactaacagct
gaagctgataaaaccattaaagtatacagagaggatgacacagccacagaagaaactcat
ccagtcagctggaaaccagaaattatcaagagaaagagattttaa

DBGET integrated database retrieval system