KEGG   Homo sapiens (human): 5359Help
Entry
5359              CDS       T01001                                 

Gene name
PLSCR1, MMTRA1B
Definition
(RefSeq) phospholipid scramblase 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Scramblase
Motif
Other DBs
NCBI-GeneID: 5359
NCBI-ProteinID: NP_066928
OMIM: 604170
HGNC: 9092
Ensembl: ENSG00000188313
Vega: OTTHUMG00000159427
Pharos: O15162(Tbio)
UniProt: O15162
Position
3q24
AA seq 318 aa AA seqDB search
MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAG
FPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVL
TGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLR
CSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCC
GDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLI
DFMFFESTGSQEQKSGVW
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacaaaactcacagatgaatgcttctcacccggaaacaaacttgccagttggg
tatcctcctcagtatccaccgacagcattccaaggacctccaggatatagtggctaccct
gggccccaggtcagctacccacccccaccagccggccattcaggtcctggcccagctggc
tttcctgtcccaaatcagccagtgtataatcagccagtatataatcagccagttggagct
gcaggggtaccatggatgccagcgccacagcctccattaaactgtccacctggattagaa
tatttaagtcagatagatcagatactgattcatcagcaaattgaacttctggaagtttta
acaggttttgaaactaataacaaatatgaaattaagaacagctttggacagagggtttac
tttgcagcggaagatactgattgctgtacccgaaattgctgtgggccatctagacctttt
accttgaggattattgataatatgggtcaagaagtcataactctggagagaccactaaga
tgtagcagctgttgttgtccctgctgccttcaggagatagaaatccaagctcctcctggt
gtaccaataggttatgttattcagacttggcacccatgtctaccaaagtttacaattcaa
aatgagaaaagagaggatgtactaaaaataagtggtccatgtgttgtgtgcagctgttgt
ggagatgttgattttgagattaaatctcttgatgaacagtgtgtggttggcaaaatttcc
aagcactggactggaattttgagagaggcatttacagacgctgataactttggaatccag
ttccctttagaccttgatgttaaaatgaaagctgtaatgattggtgcctgtttcctcatt
gacttcatgttttttgaaagcactggcagccaggaacaaaaatcaggagtgtggtag

DBGET integrated database retrieval system