KEGG   Homo sapiens (human): 5360Help
Entry
5360              CDS       T01001                                 

Gene name
PLTP, BPIFE, HDLCQ9
Definition
(RefSeq) phospholipid transfer protein
  KO
K08761  phospholipid transfer protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    5360 (PLTP)
  09154 Digestive system
   04979 Cholesterol metabolism
    5360 (PLTP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    5360 (PLTP)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   5360 (PLTP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LBP_BPI_CETP_C LBP_BPI_CETP
Motif
Other DBs
NCBI-GeneID: 5360
NCBI-ProteinID: NP_006218
OMIM: 172425
HGNC: 9093
Ensembl: ENSG00000100979
Vega: OTTHUMG00000033047
Pharos: P55058(Tbio)
UniProt: P55058
Position
20q13.12
AA seq 493 aa AA seqDB search
MALFGALFLALLAGAHAEFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGH
FYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLGLRFRRQLLYWFFYDGGYINASA
EGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFKKVYDFLSTFITSGMRFLL
NQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNLDMDFRGAFFP
LTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDSAMESYFRAGALQLLLVGDKVPHDLD
MLLRATYFGSIVLLSPAVIDSPLKLELRVLAPPRCTIKPSGTTISVTASVTIALVPPDQP
EVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNHSALESLALIPLQAPLKTMLQI
GVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLREVIEKNRPADV
RASTAPTPSTAAV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggccctcttcggggccctcttcctagcgctgctggcaggcgcacatgcagagttccca
ggctgcaagatccgcgtcacctccaaggcgctggagctggtgaagcaggaggggctgcgc
tttctggagcaagagctggagactatcaccattccggacctgcggggcaaagaaggccac
ttctactacaacatctctgaggtgaaggtcacagagctgcaactgacatcttccgagctc
gatttccagccacagcaggagctgatgcttcaaatcaccaatgcctccttggggctgcgc
ttccggagacagctgctctactggttcttctatgatgggggctacatcaacgcctcagct
gagggtgtgtccatccgcactggtctggagctctcccgggatcccgctggacggatgaaa
gtgtccaatgtctcctgccaggcctctgtctccagaatgcacgcggccttcgggggaacc
ttcaagaaggtgtatgattttctctccacgttcatcacctcagggatgcgcttcctcctc
aaccagcagatctgccctgtcctctaccacgcagggacggtcctgctcaactccctcctg
gacaccgtgcctgtgcgcagttctgtggacgagcttgttggcattgactattccctcatg
aaggatcctgtggcttccaccagcaacctggacatggacttccggggggccttcttcccc
ctgactgagaggaactggagcctccccaaccgggcagtggagccccagctgcaggaggaa
gagcggatggtgtatgtggccttctctgagttcttcttcgactctgccatggagagctac
ttccgggcgggggccctgcagctgttgctggtgggggacaaggtgccccacgacctggac
atgctgctgagggccacctactttgggagcattgtcctgctgagcccagcagtgattgac
tccccattgaagctggagctgcgggtcctggccccaccgcgctgcaccatcaagccctct
ggcaccaccatctctgtcactgctagcgtcaccattgccctggtcccaccagaccagcct
gaggtccagctgtccagcatgactatggacgcccgtctcagcgccaagatggctctccgg
gggaaggccctgcgcacgcagctggacctgcgcaggttccgaatctattccaaccattct
gcactggagtcgctggctctgatcccattacaggcccctctgaagaccatgctgcagatt
ggggtgatgcccatgctcaatgagcggacctggcgtggggtgcagatcccactacctgag
ggcatcaactttgtgcatgaggtggtgacgaaccatgcgggattcctcaccatcggggct
gatctccactttgccaaagggctgcgagaggtgattgagaagaaccggcctgctgatgtc
agggcgtccactgcccccacaccgtccacagcagctgtctga

DBGET integrated database retrieval system