KEGG   Homo sapiens (human): 53616Help
Entry
53616             CDS       T01001                                 

Gene name
ADAM22, ADAM_22, EIEE61, MDC2
Definition
(RefSeq) ADAM metallopeptidase domain 22
  KO
K16068  disintegrin and metalloproteinase domain-containing protein 22 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    53616 (ADAM22)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     53616 (ADAM22)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   53616 (ADAM22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin Pep_M12B_propep ADAM_CR Disintegrin Reprolysin_3 EGF_2 Reprolysin_2 ADAM_CR_2
Motif
Other DBs
NCBI-GeneID: 53616
NCBI-ProteinID: NP_068369
OMIM: 603709
HGNC: 201
Ensembl: ENSG00000008277
Vega: OTTHUMG00000137417
Pharos: Q9P0K1(Tbio)
UniProt: Q9P0K1
Structure
PDB: 

Position
7q21.12
AA seq 906 aa AA seqDB search
MQAAVAVSVPFLLLCVLGTCPPARCGQAGDASLMELEKRKENRFVERQSIVPLRLIYRSG
GEDESRHDALDTRVRGDLGGPQLTHVDQASFQVDAFGTSFILDVVLNHDLLSSEYIERHI
EHGGKTVEVKGGEHCYYQGHIRGNPDSFVALSTCHGLHGMFYDGNHTYLIEPEENDTTQE
DFHFHSVYKSRLFEFSLDDLPSEFQQVNITPSKFILKPRPKRSKRQLRRYPRNVEEETKY
IELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFA
ISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEF
GKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIE
EYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKCTLT
QDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQG
ICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLC
GYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQ
MMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCNTYFPHNDD
AKTGITLSGNGVAGTNIIIGIIAGTILVLALILGITAWGYKNYREQRQLPQGDYVKKPGD
GDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLG
GNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSAR
LWETSI
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcggcagtggctgtgtccgtgcccttcttgctgctctgtgtcctggggacctgc
cctccggcgcgctgcggccaggcaggagacgcctcattgatggagctagagaagaggaag
gaaaaccgcttcgtggagcgccagagcatcgtgccactgcgcctcatctaccgctcgggc
ggcgaagacgaaagtcggcacgacgcgctcgacacgcgggtgcggggcgacctcggtggc
ccgcagttgactcatgttgaccaagcaagcttccaggttgatgcctttggaacgtcattc
attctcgatgtcgtgctaaatcatgatttgctgtcctctgaatacatagagagacacatt
gaacatggaggcaagactgtggaagttaaaggaggagagcactgttactaccagggccat
atccgaggaaaccctgactcatttgttgcattgtcaacatgccacggacttcatgggatg
ttctatgacgggaaccacacatatctcattgagccagaagaaaatgacactactcaagag
gatttccattttcattcagtttacaaatccagactgtttgaattttccttggatgatctt
ccatctgaatttcagcaagtaaacattactccatcaaaatttattttgaagccaagacca
aaaaggagtaaacggcagcttcgtcgatatcctcgtaatgtagaagaagaaaccaaatac
attgaactgatgattgtgaatgatcaccttatgtttaaaaaacatcggctttccgttgta
cataccaatacctatgcgaaatctgtggtgaacatggcagatttaatatataaagaccaa
cttaagaccaggatagtattggttgctatggaaacctgggcgactgacaacaagtttgcc
atatctgaaaatccattgatcaccctacgtgagtttatgaaatacaggagggattttatc
aaagagaaaagtgatgcagttcaccttttttcgggaagtcaatttgagagtagccggagc
ggggcagcttatattggtgggatttgctcgttgctgaaaggaggaggcgtgaatgaattt
gggaaaactgatttaatggctgttacacttgcccagtcattagcccataatattggtatt
atctcagacaaaagaaagttagcaagtggtgaatgtaaatgcgaggacacgtggtccggg
tgcataatgggagacactggctattatcttcctaaaaagttcacccagtgtaatattgaa
gagtatcatgacttcctgaatagtggaggtggtgcctgccttttcaacaaaccttctaag
cttcttgatcctcctgagtgtggcaatggcttcattgaaactggagaggagtgtgattgt
ggaaccccggccgaatgtgtccttgaaggagcagagtgttgtaagaaatgcaccttgact
caagactctcaatgcagtgacggtctttgctgtaaaaagtgcaagtttcagcctatgggc
actgtgtgccgagaagcagtaaatgattgtgatattcgtgaaacgtgctcaggaaattca
agccagtgtgcccctaatattcataaaatggatggatattcatgtgatggtgttcaggga
atttgctttggaggaagatgcaaaaccagagatagacaatgcaaatacatttgggggcaa
aaggtgacagcatcagacaaatattgctatgagaaactgaatattgaagggacggagaag
ggtaactgtgggaaagacaaagacacatggatacagtgcaacaaacgggatgtgctttgt
ggttaccttttgtgtaccaatattggcaatatcccaaggcttggagaactcgatggtgaa
atcacatctactttagttgtgcagcaaggaagaacattaaactgcagtggtgggcatgtt
aagcttgaagaagatgtagatcttggctatgtggaagatgggacaccttgtggtccccaa
atgatgtgcttagaacacaggtgtcttcctgtggcttctttcaactttagtacttgcttg
agcagtaaagaaggcactatttgctcaggaaatggagtttgcagtaatgagctgaagtgt
gtgtgtaacagacactggataggttctgattgcaacacttacttccctcacaatgatgat
gcaaagactggtatcactctgtctggcaatggtgttgctggcaccaatatcataataggc
ataattgctggcaccattttagtgctggccctcatattaggaataactgcgtggggttat
aaaaactatcgagaacagagacagttaccccagggagattatgtaaaaaagcctggagat
ggtgactctttttatagcgacattcctcccggagtcagcacaaactcagcatctagttct
aagaagaggtcaaatgggctctctcattcttggagtgaaaggattccagacacaaaacat
atttcagacatctgtgaaaatgggcgacctcgaagtaactcttggcaaggtaacctggga
ggcaacaaaaagaaaatcagaggcaaaagatttagacctcggtctaattcaactgagact
ttatctcctgccaagtctccttcttcatcaactgggtctattgcctccagcagaaaatac
ccttacccaatgcctccacttcctgatgaggacaagaaagtgaaccgacaaagtgccagg
ctatgggagacatccatttaa

DBGET integrated database retrieval system