KEGG   Homo sapiens (human): 5362Help
Entry
5362              CDS       T01001                                 

Gene name
PLXNA2, OCT, PLXN2
Definition
(RefSeq) plexin A2
  KO
K06820  plexin A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    5362 (PLXNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG PSI RasGAP IncA
Motif
Other DBs
NCBI-GeneID: 5362
NCBI-ProteinID: NP_079455
OMIM: 601054
HGNC: 9100
Ensembl: ENSG00000076356
Vega: OTTHUMG00000036564
Pharos: O75051(Tbio)
UniProt: O75051
Structure
PDB: 

Position
1q32.2
AA seq 1894 aa AA seqDB search
MEQRRPWPRALEVDSRSVVLLSVVWVLLAPPAAGMPQFSTFHSENRDWTFNHLTVHQGTG
AVYVGAINRVYKLTGNLTIQVAHKTGPEEDNKSCYPPLIVQPCSEVLTLTNNVNKLLIID
YSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKTGTMYGVIVRSEGEDG
KLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSLIKIPSDTLALVSHFD
IFYIYGFASGGFVYFLTVQPETPEGVAINSAGDLFYTSRIVRLCKDDPKFHSYVSLPFGC
TRAGVEYRLLQAAYLAKPGDSLAQAFNITSQDDVLFAIFSKGQKQYHHPPDDSALCAFPI
RAINLQIKERLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDDNFCGLDINQPLGGSTPVE
GLTLYTTSRDRMTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGS
PILRDMAFSIDQRYLYVMSERQVTRVPVESCEQYTTCGECLSSGDPHCGWCALHNMCSRR
DKCQQAWEPNRFAASISQCVSLAVHPSSISVSEHSRLLSLVVSDAPDLSAGIACAFGNLT
EVEGQVSGSQVICISPGPKDVPVIPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCSAHQ
LCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISEDCPQLVPTEEILIPVGEVKPI
TLKARNLPQPQSGQRGYECVLNIQGAIHRVPALRFNSSSVQCQNSSYQYDGMDISNLAVD
FAVVWNGNFIIDNPQDLKVHLYKCAAQRESCGLCLKADRKFECGWCSGERRCTLHQHCTS
PSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAGVP
CTPLPGEYIIAEQIVCEMGHALVGTTSGPVRLCIGECKPEFMTKSHQQYTFVNPSVLSLN
PIRGPESGGTMVTITGHYLGAGSSVAVYLGNQTCEFYGRSMSEIVCVSPPSSNGLGPVPV
SVSVDRAHVDSNLQFEYIDDPRVQRIEPEWSIASGHTPLTITGFNLDVIQEPRIRVKFNG
KESVNVCKVVNTTTLTCLAPSLTTDYRPGLDTVERPDEFGFVFNNVQSLLIYNDTKFIYY
PNPTFELLSPTGVLDQKPGSPIILKGKNLCPPASGGAKLNYTVLIGETPCAVTVSETQLL
CEPPNLTGQHKVMVHVGGMVFSPGSVSVISDSLLTLPAIVSIAAGGSLLLIIVIIVLIAY
KRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRSGIPYLDYRTY
AMRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRSFSM
RDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLRRTESVAEKMLTN
WFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTL
ILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDLEWRQGRI
ARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISR
YDSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIYLTR
LLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKS
NCLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLY
AKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKY
SEELIGALEQDEQARRQRLAYKVEQLINAMSIES
NT seq 5685 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaggcggccctggccccgggccctggaggtggacagccgctctgtggtcctg
ctctcagtggtctgggtgctgctggcccccccagcagccggcatgcctcagttcagcacc
ttccactctgagaatcgtgactggaccttcaaccacttgaccgtccaccaagggacgggg
gccgtctatgtgggggccatcaaccgggtctataagctgacaggcaacctgaccatccag
gtggctcataagacagggccagaagaggacaacaagtcttgttacccgcccctcatcgtg
cagccctgcagcgaagtgctcaccctcaccaacaatgtcaacaagctgctcatcattgac
tactctgagaaccgcctgctggcctgtgggagcctctaccagggggtctgcaagctgctg
cggctggatgacctcttcatcctggtggagccatcccacaagaaggagcactacctgtcc
agtgtcaacaagacgggcaccatgtacggggtgattgtgcgctctgagggtgaggatggc
aagctcttcatcggcacggctgtggatgggaagcaggattacttcccgaccctgtccagc
cggaagctgccccgagaccctgagtcctcagccatgctcgactatgagctacacagcgat
tttgtctcctctctcatcaagatcccttcagacaccctggccctggtctcccactttgac
atcttctacatctacggctttgctagtgggggctttgtctactttctcactgtccagccc
gagacccctgagggtgtggccatcaactccgctggagacctcttctacacctcacgcatc
gtgcggctctgcaaggatgaccccaagttccactcatacgtgtccctgcccttcggctgc
acccgggccggggtggaataccgcctcctgcaggctgcttacctggccaagcctggggac
tcactggcccaggccttcaatatcaccagccaggacgatgtactctttgccatcttctcc
aaagggcagaagcagtatcaccacccgcccgatgactctgccctgtgtgccttccctatc
cgggccatcaacttgcagatcaaggagcgcctgcagtcctgctaccagggcgagggcaac
ctggagctcaactggctgctggggaaggacgtccagtgcaccaaggcgcctgtccccatc
gatgataacttctgtggactggacatcaaccagcccctgggaggctcaactccagtggag
ggcctgaccctgtacaccaccagcagggaccgcatgacctctgtggcctcctacgtttac
aacggctacagcgtggtttttgtggggactaagagtggcaagctgaaaaagattcgggcc
gacggtcccccccatggtggggtccagtacgagatggtctctgtgctcaaggacggaagc
cccatcctccgggacatggccttctccattgatcagcgctacctgtacgtcatgtctgag
agacaggtcaccagggtccccgtggagtcatgtgagcagtatacgacttgtggggagtgc
ctgagctctggggaccctcactgtggctggtgtgccctgcacaacatgtgctcccgcagg
gacaaatgccaacaggcctgggaacctaatcgatttgctgccagcatcagccagtgtgtg
agccttgcagtgcatcccagcagcatctcagtatctgagcacagccggttgcttagcctg
gtagtgagtgatgctcctgatctatctgcgggtatcgcctgtgcctttgggaacctgaca
gaggtggaggggcaggtgtccgggagccaggtcatctgcatctcacctgggcccaaggat
gtccctgtcatcccgctggatcaagactggtttgggctggagctacagctgaggtccaag
gagacagggaagatatttgtcagcaccgagttcaagttttacaactgcagtgcccaccaa
ctgtgcctgtcctgtgtcaacagcgccttccgctgccattggtgcaagtaccgcaacctc
tgcactcatgaccccaccacctgctccttccaggagggccggatcaatatttcagaggac
tgtccccagctggtgcccacagaggagatcttgattccagtcggggaggtaaagccaatc
acccttaaggcgcgaaatctgccccagccgcagtccggccagcgaggctatgagtgtgtc
ctcaacatacaaggagccatccaccgggtccccgctctgcgcttcaacagctccagcgtt
cagtgtcagaacagctcgtaccagtatgatggcatggacatcagcaatctggccgtggat
ttcgctgtggtgtggaacggcaatttcatcattgacaaccctcaggacctgaaagtccat
ctctacaagtgtgcagcccagcgggagagctgcggcctctgcctcaaggccgaccggaag
tttgagtgtggctggtgcagcggcgagcgcaggtgcaccctccaccagcactgtaccagc
ccttccagcccctggctcgactggtccagccacaatgtcaagtgctccaaccctcaaatc
accgagattttgacggtgtctggaccgccggaaggagggacgcgagtgaccatccatggc
gtgaacctgggtctggacttctccgagatcgcccaccatgtgcaggtggctggggtgccc
tgcacgcccctcccaggggaatacatcatcgctgagcagattgtctgtgagatgggccat
gccctcgtgggaaccacctccgggccagtacgcctgtgtattggcgagtgtaagccagag
ttcatgacgaagtcccatcagcagtacaccttcgtgaacccttctgtgctgtcactcaac
ccaatccgaggtcccgagtcaggaggcactatggtgaccattaccggccattaccttggg
gctgggagcagcgtggcagtctacctgggcaaccagacctgcgagttctacgggaggtca
atgagtgagatcgtgtgtgtctcacccccatcatccaatggccttggcccggtccctgtt
tctgtgagtgtcgaccgagcccatgtggatagcaacctgcagtttgagtacatagatgac
cctcgggtccagcgcatcgagccagagtggagcattgccagtggccacacacccctgacc
atcacaggcttcaacctggatgtcattcaggagccaaggatccgagtcaaattcaatggc
aaagaatctgtcaatgtgtgtaaagttgtgaacacaaccaccctcacctgcctggcaccc
tctctgaccacggactaccgccctggcctggacactgtggaacgcccagatgagtttgga
tttgtctttaacaatgtccaatccttgctaatttacaacgacaccaagtttatctactac
cccaacccgacctttgaactgcttagccctactggagtcttggatcaaaagccaggatcg
cccatcattctgaagggcaaaaacctctgccctcctgcctctggaggggccaaactcaac
tacactgtgctcatcggagagaccccttgtgctgtcaccgtatctgagacccagcttctc
tgcgagcctcccaacctcaccgggcagcacaaggtcatggttcacgtgggcgggatggtg
ttctcgcctggctcggtgagtgtcatctcagacagcttgctgaccctgccagccatcgtc
agcatcgcggccggcggcagcctcctcctcatcatcgtcatcatcgtcctcattgcctac
aagcgcaagtctcgagaaaatgacctcactctcaagcggctgcaaatgcagatggacaat
ctggagtcccgtgtggccttggagtgcaaggaagcttttgctgagctccagacggatatc
aatgagttgaccagtgacctggaccgctcaggaatcccttacctggactatcgtacctac
gctatgcgagtcctgttcccgggcatcgaggaccaccccgtcctgcgggagctggaggta
caaggaaacgggcagcagcacgtggagaaggccctgaagctctttgcccagctcatcaac
aacaaggtgttcctgctgaccttcatccgcaccctggagctgcagcgcagtttctccatg
cgcgaccggggcaacgtggcttcgctcatcatgaccggcctgcagggccgcctggaatat
gccactgatgtcctcaagcagctgctctctgacctcatcgataagaacctggagaacaag
aaccaccccaagctgctactccggaggacagagtctgtggctgaaaagatgctgaccaat
tggttcgccttcctcctgcacaagttcctaaaggagtgcgcaggggagccactcttcatg
ctatactgtgccatcaagcagcagatggagaagggccccattgatgccatcacgggcgag
gcccgctactccctgagcgaggacaagctcatccggcagcagatcgagtacaagaccctg
atcctgaactgcgtcaaccctgacaacgagaacagtccagagatcccagtgaaggtgtta
aactgtgacaccatcacacaggtcaaggagaagattcttgatgccgtgtataagaatgtg
ccctattcccagcggccgagggcagtggacatggacttggagtggcgccaaggccggatc
gcccgggtcgtgctgcaagatgaggacatcaccaccaagattgagggtgactggaagcgg
ctcaacacactgatgcattatcaggtgtcagacaggtcggtggtggctctggtccccaaa
cagacctcctcctacaacatccctgcctctgccagcatctcccggacgtccatcagcaga
tacgactcctccttcaggtatacgggcagccccgacagcctgcggtcccgggccccgatg
atcaccccagacctggaaagtggggtcaaggtgtggcatctggtgaagaaccatgaccac
ggtgaccagaaggagggtgaccggggcagcaagatggtgtccgagatctacctgacccgg
ctactggccaccaagggcaccctgcagaagtttgtggacgacttgtttgagaccttgttc
agcactgtgcaccggggcagcgctctccccctggccatcaagtacatgtttgatttccta
gatgagcaggcagacaggcacagcatccatgacacagatgtgcggcacacctggaaaagc
aactgcctccctctgcgcttctgggtgaacgtgattaagaacccccagttcgtgtttgac
atccacaagggcagcatcacggacgcctgcctctctgtggtggcccagaccttcatggac
tcttgttcaacgtcagagcaccggctgggcaaggactccccctccaacaagctgctctat
gccaaggacatccccagctacaagagctgggtggagagatactacgcagacatcgccaag
ctcccagccatcagtgaccaggacatgaatgcctacctcgccgagcagtcccgcctgcac
gccgtggagttcaacatgctgagtgccctcaatgagatctactcctatgtcagcaagtat
agtgaggagctcatcggggccctagagcaggatgagcaggcacggcggcagcggctggct
tataaggtggagcagctcattaatgccatgtccattgagagctga

DBGET integrated database retrieval system