KEGG   Homo sapiens (human): 53637Help
Entry
53637             CDS       T01001                                 

Gene name
S1PR5, EDG8, Edg-8, S1P5, SPPR-1, SPPR-2
Definition
(RefSeq) sphingosine-1-phosphate receptor 5
  KO
K04295  sphingosine 1-phosphate receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Amiselimod (DG02399): D10904 D10905
Etrasimod (DG02444): D10930
Ozanimod (DG02827): D10967 D10968
Siponimod fumaric acid: D11072
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    53637 (S1PR5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    53637 (S1PR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    53637 (S1PR5)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    53637 (S1PR5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 53637
NCBI-ProteinID: NP_001159687
OMIM: 605146
HGNC: 14299
Ensembl: ENSG00000180739
Vega: OTTHUMG00000180581
Pharos: Q9H228(Tclin)
UniProt: Q9H228
Position
19p13.2
AA seq 398 aa AA seqDB search
MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV
LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT
ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD
ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA
RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggggctgctgcggccggcgccggtgagcgaggtcatcgtcctgcattacaac
tacaccggcaagctccgcggtgcgcgctaccagccgggtgccggcctgcgcgccgacgcc
gtggtgtgcctggcggtgtgcgccttcatcgtgctagagaatctagccgtgttgttggtg
ctcggacgccacccgcgcttccacgctcccatgttcctgctcctgggcagcctcacgttg
tcggatctgctggcaggcgccgcctacgccgccaacatcctactgtcggggccgctcacg
ctgaaactgtcccccgcgctctggttcgcacgggagggaggcgtcttcgtggcactcact
gcgtccgtgctgagcctcctggccatcgcgctggagcgcagcctcaccatggcgcgcagg
gggcccgcgcccgtctccagtcgggggcgcacgctggcgatggcagccgcggcctggggc
gtgtcgctgctcctcgggctcctgccagcgctgggctggaattgcctgggtcgcctggac
gcttgctccactgtcttgccgctctacgccaaggcctacgtgctcttctgcgtgctcgcc
ttcgtgggcatcctggccgctatctgtgcactctacgcgcgcatctactgccaggtacgc
gccaacgcgcggcgcctgccggcacggcccgggactgcggggaccacctcgacccgggcg
cgtcgcaagccgcgctcgctggccttgctgcgcacgctcagcgtggtgctcctggccttt
gtggcatgttggggccccctcttcctgctgctgttgctcgacgtggcgtgcccggcgcgc
acctgtcctgtactcctgcaggccgatcccttcctgggactggccatggccaactcactt
ctgaaccccatcatctacacgctcaccaaccgcgacctgcgccacgcgctcctgcgcctg
gtctgctgcggacgccactcctgcggcagagacccgagtggctcccagcagtcggcgagc
gcggctgaggcttccgggggcctgcgccgctgcctgcccccgggccttgatgggagcttc
agcggctcggagcgctcatcgccccagcgcgacgggctggacaccagcggctccacaggc
agccccggtgcacccacagccgcccggactctggtatcagaaccggctgcagactga

DBGET integrated database retrieval system