KEGG   Homo sapiens (human): 5364Help
Entry
5364              CDS       T01001                                 

Gene name
PLXNB1, PLEXIN-B1, PLXN5, SEP
Definition
(RefSeq) plexin B1
  KO
K06821  plexin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    5364 (PLXNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG TIG_2 PSI TIG_plexin
Motif
Other DBs
NCBI-GeneID: 5364
NCBI-ProteinID: NP_001123554
OMIM: 601053
HGNC: 9103
Ensembl: ENSG00000164050
Vega: OTTHUMG00000133527
Pharos: O43157(Tbio)
UniProt: O43157
Structure
PDB: 

Position
3p21.31
AA seq 2135 aa AA seqDB search
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSP
GLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCE
QRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQ
SRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSA
APPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDV
NSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAF
LGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVA
SCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLP
RGADYVSVSVELRFGAVVIAKTSLSFYDCVAVTELRPSAQCQACVSSRWGCNWCVWQHLC
THKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTAT
ASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTDFRP
SATPEDLLASPLSPSEVAAVPPADPGPEALHPTVPLDLPPATVPATTFPGAMGSVKPALD
WLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQYDTPGL
WELEEATLGASSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELEGLE
VVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLY
DCSVGHGDCSRCQTAMPQYGCVWCEGERPRCVTREACGEAEAVATQCPAPLIHSVEPLTG
PVDGGTRVTIRGSNLGQHVQDVLGMVTVAGVPCAVDAQEYEVSSSLVCITGASGEEVAGA
TAVEVPGRGRGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTGRLEDIRVVVG
DQPCHLLPEQQSEQLRCETSPRPTPATLPVAVWFGATERRLQRGQFKYTLDPNITSAGPT
KSFLSGGREICVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSS
QQFEEPCHVNSSQLITCRTPALPGLPEDPWVRVEFILDNLVFDFATLNPTPFSYEADPTL
QPLNPEDPTMPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPP
VEQPLPRHHALREAPDSLPEFTVQMGNLRFSLGHVQYDGESPGAFPVAAQVGLGVGTSLL
ALGVIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLG
SGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFI
HTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTE
TVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLL
REDVEYRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDP
RTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRE
NQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYLT
RLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNS
LPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYAR
DIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKYINKYYD
QIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL
NT seq 6408 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctctgggcccagctcttctccaggctctctgggccgggtgggtcctcaccctc
cagccccttccaccaactgcattcactcccaatggcacgtatctgcagcacctggcaagg
gaccccacctcaggcaccctctacctgggggctaccaacttcctgttccagctgagccct
gggctgcagctggaggccacagtgtccaccggccctgtgctagacagcagggactgcctg
ccacctgtgatgcctgatgagtgcccccaggcccagcctaccaacaacccgaatcagctg
ctcctggtgagcccaggggccctggtggtatgcgggagcgtgcaccagggggtctgtgaa
cagcggcgcctggggcagctcgagcagctgctgctgcggccagagcggcctggggacaca
caatatgtggctgccaatgatcctgcggtcagcacggtggggctggtagcccagggcttg
gcaggggagcccctcctgtttgtggggcgaggatacaccagcaggggtgtggggggtggc
attccacccatcacaacccgggccctgtggccgcccgacccccaagctgccttctcctat
gaggagacagccaagctggcagtgggccgcctctccgagtacagccaccacttcgtgagt
gcctttgcacgtggggccagcgcctacttcctgttcctgcggcgggacctgcaggctcag
tctagagcttttcgtgcctatgtatctcgagtgtgtctccgggaccagcactactactcc
tatgtggagttgcctctggcctgcgaaggtggccgctacgggctgatccaggctgcagct
gtggccacgtccagggaggtggcgcatggggaggtgctctttgcagctttctcctcggct
gcaccccccactgtgggccggcccccatcggcggctgctggggcatctggagcctctgcc
ctctgtgccttccccctggatgaggtggaccggcttgctaatcgcacgcgagatgcctgc
tacacccgggagggtcgtgctgaggatgggaccgaggtggcctacatcgagtatgatgtc
aattctgactgtgcacagctgccagtggacaccctggatgcttatccctgtggctcagac
cacacgcccagccccatggccagccgggtcccgctggaagccacaccaattctggagtgg
ccagggattcagctaacagctgtggcagtcaccatggaagatggacacaccatcgctttc
ctgggtgatagtcaagggcagctgcacagggtctacttgggcccagggagcgatggccac
ccatactccacacagagcatccagcaggggtctgcagtgagcagagacctcacctttgat
gggacctttgagcacctgtatgtcatgacccagagcacacttctgaaggttcctgtggct
tcctgtgctcagcacctggactgtgcatcttgccttgctcacagggacccatactgtggg
tggtgcgtgctccttggcaggtgcagtcgccgttctgagtgctcgaggggccagggccca
gagcagtggctatggagcttccagcctgagctgggctgtctgcaagtggcagccatgagt
cctgccaacatcagccgagaggagacgagggaggttttcctatcagtgccagacctgcca
cccctgtggccaggggagtcatattcctgccactttggggaacatcagagtcctgccctg
ctgactggttctggtgtgatgtgcccctccccagaccctagtgaggccccagtgctgccg
agaggagccgactacgtatccgtgagcgtggagctcagatttggcgctgttgtgatcgcc
aaaacttccctctctttctatgactgtgtggcggtcactgaactccgcccatctgcgcag
tgccaggcctgtgtgagcagccgctgggggtgtaactggtgtgtctggcagcacctgtgc
acccacaaggcctcgtgtgatgctgggcccatggttgcaagccatcagagcccgcttgtc
tccccagaccctcctgcaagaggtggacccagcccctccccacccacagcccccaaagcc
ctggccacccctgctcctgacacccttcccgtggagcctggggctccctccacagccaca
gcttcggacatctcacctggggctagtccttccctgctcagcccctgggggccatgggca
ggttctggctccatatcttcccctggctccacagggtcgcctctccatgaggagccctcc
cctcccagcccccaaaatggacctggaaccgctgtccctgcccccactgacttcagaccc
tcagccacacctgaggacctcttggcctccccgctgtcaccctcagaggtagcagcagtg
ccccctgcagaccctggccccgaggctcttcatcccacagtgcccctggacctgccccct
gccactgttcctgccaccactttcccaggggccatgggctccgtgaagcccgccctggac
tggctcacgagagaaggcggcgagctgcccgaggcggacgagtggacggggggtgacgca
cccgccttctccacttccaccctcctctcaggtgatggagactcagcagagcttgagggc
cctcccgcccccctcatcctcccgtccagcctcgactaccagtatgacacccccgggctc
tgggagctggaagaggcgaccttgggggcaagctcctgcccctgtgtggagagcgttcag
ggctccacgttgatgccggtccatgtggagcgggaaatccggctgctaggcaggaacctg
caccttttccaggatggcccaggagacaatgagtgtgtgatggagctggagggcctcgag
gtggtggttgaggcccgggtcgagtgtgagccacctccagatacccagtgccatgtcacc
tgccagcagcaccagctcagctatgaggctctgcagccggagctccgtgtggggctgttt
ctgcgtcgggccggccgtctgcgtgtggacagtgctgaggggctgcatgtggtactgtat
gactgttccgtgggacatggagactgcagccgctgccaaactgccatgccccagtatggc
tgtgtgtggtgtgagggggagcgtccacgttgtgtgacccgggaggcctgtggtgaggct
gaggctgtggccacccagtgcccagcgcccctcatccactcggtggagccactgactggg
cctgtagacggaggcacccgtgtcaccatcaggggctccaacctgggccagcatgtgcag
gatgtgctgggcatggtcacggtggctggagtgccctgtgctgtggatgcccaggagtac
gaggtctccagcagcctcgtgtgcatcaccggggccagtggggaggaggtggccggcgcc
acagcggtggaggtgccgggaagaggacgtggtgtctcagaacacgactttgcctaccag
gatccgaaggtccattccatcttcccggcccgcggccccagagctgggggcacccgtctc
accctgaatggctccaagctcctgactgggcggctggaggacatccgagtggtggttgga
gaccagccttgtcacttgctgccggagcagcagtcagaacaactgcggtgtgagaccagc
ccacgccccacgcctgccacgctccctgtggctgtgtggtttggggccacggagcggagg
cttcaacgcggacagttcaagtataccttggaccccaacatcacctctgctggccccacc
aagagcttcctcagtggaggacgtgagatatgcgtccgtggccagaatctggacgtggta
cagacgccaagaatccgggtgaccgtggtctcgagaatgctgcagcccagccaggggctt
ggacggaggcgtcgcgtggtcccggagacggcatgttcccttggaccctcctgcagtagc
cagcaatttgaggagccgtgccatgtcaactcctcccagctcatcacgtgccgcacacct
gccctcccaggcctgcctgaggacccctgggtccgggtggaatttatccttgacaacctg
gtctttgactttgcaacactgaaccccacacctttctcctatgaggccgaccccaccctg
cagccactcaaccctgaggaccccaccatgccattccggcacaagcctgggagtgtgttc
tccgtggagggggagaacctggaccttgcaatgtccaaggaggaggtggtggctatgata
ggggatggcccctgtgtggtgaagacgctgacgcggcaccacctgtactgcgagcccccc
gtggagcagcccctgccacggcaccatgccctccgagaggcacctgactctttgcctgag
ttcacggtgcagatggggaacttgcgcttctccctgggtcacgtgcagtatgacggcgag
agccctggggcttttcctgtggcagcccaggtgggcttgggggtgggcacctctcttctg
gctctgggtgtcatcatcattgtcctcatgtacaggaggaagagcaagcaggccctgagg
gactataagaaggttcagatccagctggagaatctggagagcagtgtgcgggaccgctgc
aagaaggaattcacagacctcatgactgagatgaccgatctcaccagtgacctcctgggc
agcggcatccccttcctcgactacaaggtgtatgcggagaggatcttcttccctgggcac
cgcgagtcgcccttgcaccgggacctgggtgtgcctgagagcagacggcccactgtggag
caagggctggggcagctctctaacctgctcaacagcaagctcttcctcaccaagttcatc
cacacgctggagagccagcgcaccttttcagctcgggaccgtgcctacgtggcatctctg
ctcaccgtggcactgcatgggaagcttgagtatttcactgacatcctccgcactctgctc
agtgacctggttgcccagtatgtggccaagaaccccaagctgatgctgcgcaggacagag
actgtggtggagaagctgctcaccaactggatgtccatctgtctgtataccttcgtgagg
gactccgtaggggagcctctgtacatgctctttcgagggattaagcaccaagtggataag
gggccagtggacagtgtgacaggcaaggccaaatacaccttgaacgacaaccgcctgctc
agagaggatgtggagtaccgtcccctgaccttgaatgcactattggctgtggggcctggg
gcaggagaggcccagggcgtgcccgtgaaggtcctagactgtgacaccatctcccaggca
aaggagaagatgctggaccagctttataaaggagtgcctctcacccagcggccagaccct
cgcacccttgatgttgagtggcggtctggggtggccgggcacctcattctttctgacgag
gatgtcacttctgaggtccagggtctgtggaggcgcctgaacacactgcagcattacaag
gtcccagatggagcaactgtggccctcgtcccctgcctcaccaagcatgtgctccgggaa
aaccaggattatgtccctggagagcggaccccaatgctggaggatgtagatgaggggggc
atccggccctggcacctggtgaagccaagtgatgagccggagccgcccaggcctcggagg
ggcagccttcggggcggggagcgtgagcgcgccaaggccatccctgagatctacctgacc
cgcctgctgtccatgaagggcaccctgcagaagttcgtggatgacctgttccaggtgatt
ctcagcaccagccgccccgtgccgctcgctgtgaagtacttctttgacctgctggatgag
caggcccagcagcatggcatctccgaccaggacaccatccacatctggaagaccaacagc
ttgcctctgaggttctggatcaatataataaaaaacccgcagtttgtgttcgacgtgcaa
acatctgataacatggatgcggtgctccttgtcattgcacagaccttcatggacgcctgc
accctggccgaccacaagctgggccgggactccccgatcaacaaacttctgtatgcacgg
gacattccccggtacaagcggatggtggaaaggtactatgcagacatcagacagactgtc
ccagccagcgaccaagagatgaactctgtcctggctgaactgtcctggaactactccgga
gacctcggggcgcgagtggccctgcatgaactctacaagtacatcaacaagtactatgac
cagatcatcactgccctggaggaggatggcacggcccagaagatgcagctgggctatcgg
ctccagcagattgcagctgctgtggaaaacaaggtcacagatctatag

DBGET integrated database retrieval system