KEGG   Homo sapiens (human): 5366Help
Entry
5366              CDS       T01001                                 

Gene name
PMAIP1, APR, NOXA
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05210  Colorectal cancer
Network
N00098  Intrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    5366 (PMAIP1)
   04215 Apoptosis - multiple species
    5366 (PMAIP1)
   04115 p53 signaling pathway
    5366 (PMAIP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5366 (PMAIP1)
   05203 Viral carcinogenesis
    5366 (PMAIP1)
   05210 Colorectal cancer
    5366 (PMAIP1)
  Drug resistance
   01524 Platinum drug resistance
    5366 (PMAIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMAIP1
Motif
Other DBs
NCBI-GeneID: 5366
NCBI-ProteinID: NP_066950
OMIM: 604959
HGNC: 9108
Ensembl: ENSG00000141682
Vega: OTTHUMG00000132765
Pharos: Q13794(Tbio)
UniProt: Q13794 A0A0S2Z490
Structure
PDB: 

Position
18q21.32
AA seq 54 aa AA seqDB search
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaagaaggcgcgcaagaacgctcaaccgagccccgcgcgggctccagcagag
ctggaagtcgagtgtgctactcaactcaggagatttggagacaaactgaacttccggcag
aaacttctgaatctgatatccaaactcttctgctcaggaacctga

DBGET integrated database retrieval system