KEGG   Homo sapiens (human): 5366Help
Entry
5366              CDS       T01001                                 

Gene name
PMAIP1, APR, NOXA
Definition
(RefSeq) phorbol-12-myristate-13-acetate-induced protein 1
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05210  Colorectal cancer
Network
N00098  Intrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    5366 (PMAIP1)
   04215 Apoptosis - multiple species
    5366 (PMAIP1)
   04115 p53 signaling pathway
    5366 (PMAIP1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    5366 (PMAIP1)
   05203 Viral carcinogenesis
    5366 (PMAIP1)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    5366 (PMAIP1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    5366 (PMAIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMAIP1
Motif
Other DBs
NCBI-GeneID: 5366
NCBI-ProteinID: NP_066950
OMIM: 604959
HGNC: 9108
Ensembl: ENSG00000141682
Vega: OTTHUMG00000132765
Pharos: Q13794(Tbio)
UniProt: Q13794 A0A0S2Z490
Structure
PDB: 

Position
18q21.32
AA seq 54 aa AA seqDB search
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaagaaggcgcgcaagaacgctcaaccgagccccgcgcgggctccagcagag
ctggaagtcgagtgtgctactcaactcaggagatttggagacaaactgaacttccggcag
aaacttctgaatctgatatccaaactcttctgctcaggaacctga

DBGET integrated database retrieval system