KEGG   Homo sapiens (human): 5368Help
Entry
5368              CDS       T01001                                 

Gene name
PNOC, N/OFQ, NOP, OFQ, PPNOC, ppN/OFQ
Definition
(RefSeq) prepronociceptin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Opiods_neuropep
Motif
Other DBs
NCBI-GeneID: 5368
NCBI-ProteinID: NP_006219
OMIM: 601459
HGNC: 9163
Ensembl: ENSG00000168081
Vega: OTTHUMG00000102125
Pharos: Q13519(Tbio)
CPD: C16044 C15871
UniProt: Q13519
Position
8p21.1
AA seq 176 aa AA seqDB search
MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTP
CTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGE
MEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcctgctttgtgacctgctgctgctcagtctcttctccagtgtgttcagcagt
tgtcagagggactgtctcacatgccaggagaagctccacccagccctggacagcttcgac
ctggaggtgtgcatcctcgagtgtgaagagaaggtcttccccagccccctctggactcca
tgcaccaaggtcatggccaggagctcttggcagctcagccctgccgccccagagcatgtg
gcggctgctctctaccagccgagagcttcggagatgcagcatctgcggcgaatgccccga
gtccggagcttgttccaggagcaggaagagcccgagcctggcatggaggaggctggtgag
atggagcagaagcagctgcagaagagatttgggggcttcaccggggcccggaagtcggcc
aggaagttggccaatcagaagcggttcagtgagtttatgaggcaatacttggtcctgagc
atgcagtccagccagcgccggcgcaccctgcaccagaatggtaatgtgtag

DBGET integrated database retrieval system