KEGG   Homo sapiens (human): 5372
Entry
5372              CDS       T01001                                 

Gene name
PMM1, PMM_1, PMMH-22, Sec53
Definition
(RefSeq) phosphomannomutase 1
  KO
K17497  phosphomannomutase [EC:5.4.2.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
Network
nt06015  N-Glycan biosynthesis
  Element
N00667  N-Glycan precursor biosynthesis, Glc-6P to Man-P-Dol
N00668  DPM1 deficiency in N-glycan precursor biosynthesis
N00669  DPM2 deficiency in N-glycan precursor biosynthesis
N00670  DPM3 deficiency in N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    5372 (PMM1)
   00520 Amino sugar and nucleotide sugar metabolism
    5372 (PMM1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     5372 (PMM1)
SSDB
Motif
Pfam: PMM Hydrolase_3
Other DBs
NCBI-GeneID: 5372
NCBI-ProteinID: NP_002667
OMIM: 601786
HGNC: 9114
Ensembl: ENSG00000100417
Vega: OTTHUMG00000150972
Pharos: Q92871(Tbio)
UniProt: Q92871 A0A024R1U5
Structure
PDB: 

Position
22q13.2
AA seq 262 aa
MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIA
EQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLR
LPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLR
FSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSV
VSPQDTVQRCREIFFPETAHEA
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcagtcaccgcccaggcagcccgcaggaaggagcgcgtcctctgcctgtttgacgtg
gacgggaccctcacgccggctcgccagaaaattgaccctgaggtggccgccttcctgcag
aagctacgaagtagagtgcagatcggtgtggtgggcggctctgactactgtaagatcgct
gagcagctgggtgacggggatgaagtcattgagaagtttgattatgtgtttgccgagaac
gggacggtgcagtataagcacggacgactgctctccaagcagaccatccagaaccacctg
ggggaggagctgctgcaggacttgatcaacttctgcctcagctacatggccctgctcagg
ctgcccaagaagcgtggaaccttcatcgagttccggaatggcatgctgaacatctcgccc
atcggccggagctgcaccctggaggagaggatcgagttctccgaactggacaagaaagag
aagatccgggagaagttcgtggaagccctgaaaacagagtttgctggcaaagggctgagg
ttctctcgaggaggcatgatcagctttgacgtcttccccgagggctgggacaagcgctac
tgcctggatagcctggaccaggacagcttcgacaccatccacttctttgggaacgagact
agccctggtgggaacgactttgagatctttgccgacccccggactgttggccacagcgtg
gtgtctcctcaggacacggtgcagcgatgccgggagattttcttcccagagacagctcat
gaggcgtga

DBGET integrated database retrieval system