KEGG   Homo sapiens (human): 5375
Entry
5375              CDS       T01001                                 
Symbol
PMP2, CMT1G, FABP8, M-FABP, MP2, P2
Name
(RefSeq) peripheral myelin protein 2
  KO
K24977  myelin P2 protein
Organism
hsa  Homo sapiens (human)
Disease
H00264  Charcot-Marie-Tooth disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    5375 (PMP2)
SSDB
Motif
Pfam: Lipocalin
Other DBs
NCBI-GeneID: 5375
NCBI-ProteinID: NP_002668
OMIM: 170715
HGNC: 9117
Ensembl: ENSG00000147588
UniProt: E5RH45
Position
8:complement(81440326..81447439)
AA seq 132 aa
MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKN
TEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKM
KGVVCTRIYEKV
NT seq 399 nt   +upstreamnt  +downstreamnt
atgagcaacaaattcctgggcacctggaaacttgtctctagtgagaactttgacgattac
atgaaagctctgggtgtggggttagccaccagaaaactgggaaatttggccaaacccact
gtgatcatcagcaagaaaggagatattataactatacgaactgaaagtacctttaaaaat
acagaaatctccttcaagctaggccaggaatttgaagaaaccacagctgacaatagaaag
accaagagcatcgtaaccctgcagagaggatcactgaatcaagtgcagagatgggatggc
aaagagacaaccataaagagaaagctagtgaatgggaaaatggtagcggaatgtaaaatg
aagggcgtggtgtgcaccagaatctatgagaaggtctga

DBGET integrated database retrieval system