KEGG   Homo sapiens (human): 53826Help
Entry
53826             CDS       T01001                                 

Gene name
FXYD6
Definition
(RefSeq) FXYD domain containing ion transport regulator 6
  KO
K13363  FXYD domain-containing ion transport regulator 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    53826 (FXYD6)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   53826 (FXYD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP1G1_PLM_MAT8 Glycophorin_A EphA2_TM
Motif
Other DBs
NCBI-GeneID: 53826
NCBI-ProteinID: NP_001158303
OMIM: 606683
HGNC: 4030
Ensembl: ENSG00000137726
Vega: OTTHUMG00000166991
Pharos: Q9H0Q3(Tbio)
UniProt: Q9H0Q3 A0A024R3J8
Position
11q23.3
AA seq 95 aa AA seqDB search
MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRR
CKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggagttggtgctggtcttcctctgcagcctgctggcccccatggtcctggccagtgca
gctgaaaaggagaaggaaatggacccttttcattatgattaccagaccctgaggattggg
ggactggtgttcgctgtggtcctcttctcggttgggatcctccttatcctaagtcgcagg
tgcaagtgcagtttcaatcagaagccccgggccccaggagatgaggaagcccaggtggag
aacctcatcaccgccaatgcaacagagccccagaaagcagagaactga

DBGET integrated database retrieval system