KEGG   Homo sapiens (human): 53831
Entry
53831             CDS       T01001                                 

Gene name
GPR84, EX33, GPCR4
Definition
(RefSeq) G protein-coupled receptor 84
  KO
K08421  G protein-coupled receptor 84
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    53831 (GPR84)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    53831 (GPR84)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx DUF1279 Git3
Other DBs
NCBI-GeneID: 53831
NCBI-ProteinID: NP_065103
OMIM: 606383
HGNC: 4535
Ensembl: ENSG00000139572
Vega: OTTHUMG00000169839
Pharos: Q9NQS5(Tbio)
UniProt: Q9NQS5
Position
12q13.13
AA seq 396 aa
MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIA
NLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYL
LIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTT
ILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQE
LDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQP
IKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTW
LNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgtggaacagctctgacgccaacttctcctgctaccatgagtctgtgctgggctatcgt
tatgttgcagttagctggggggtggtggtggctgtgacaggcaccgtgggcaatgtgctc
accctactggccttggccatccagcccaagctccgtacccgattcaacctgctcatagcc
aacctcacactggctgatctcctctactgcacgctccttcagcccttctctgtggacacc
tacctccacctgcactggcgcaccggtgccaccttctgcagggtatttgggctcctcctt
tttgcctccaattctgtctccatcctgaccctctgcctcatcgcactgggacgctacctc
ctcattgcccaccctaagctttttccccaagttttcagtgccaaggggatagtgctggca
ctggtgagcacctgggttgtgggcgtggccagctttgctcccctctggcctatttatatc
ctggtacctgtagtctgcacctgcagctttgaccgcatccgaggccggccttacaccacc
atcctcatgggcatctactttgtgcttgggctcagcagtgttggcatcttctattgcctc
atccaccgccaggtcaaacgagcagcacaggcactggaccaatacaagttgcgacaggca
agcatccactccaaccatgtggccaggactgatgaggccatgcctggtcgtttccaggag
ctggacagcaggttagcatcaggaggacccagtgaggggatttcatctgagccagtcagt
gctgccaccacccagaccctggaaggggactcatcagaagtgggagaccagatcaacagc
aagagagctaagcagatggcagagaaaagccctccagaagcatctgccaaagcccagcca
attaaaggagccagaagagctccggattcttcatcggaatttgggaaggtgactcgaatg
tgttttgctgtgttcctctgctttgccctgagctacatccccttcttgctgctcaacatt
ctggatgccagagtccaggctccccgggtggtccacatgcttgctgccaacctcacctgg
ctcaatggttgcatcaaccctgtgctctatgcagccatgaaccgccaattccgccaagca
tatggctccattttaaaaagagggccccggagtttccataggctccattag

DBGET integrated database retrieval system