KEGG   Homo sapiens (human): 53836
Entry
53836             CDS       T01001                                 

Gene name
GPR87, FKSG78, GPR95, KPG_002
Definition
(RefSeq) G protein-coupled receptor 87
  KO
K08389  G protein-coupled receptor 87
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    53836 (GPR87)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    53836 (GPR87)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Saf_2TM Ctr Alg14
Other DBs
NCBI-GeneID: 53836
NCBI-ProteinID: NP_076404
OMIM: 606379
HGNC: 4538
Ensembl: ENSG00000138271
Vega: OTTHUMG00000159858
Pharos: Q9BY21(Tbio)
UniProt: Q9BY21
Position
3q25.1
AA seq 358 aa
MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYLIIFVASILLN
GLAVWIFFHIRNKTSFIFYLKNIVVADLIMTLTFPFRIVHDAGFGPWYFKFILCRYTSVL
FYANMYTSIVFLGLISIDRYLKVVKPFGDSRMYSITFTKVLSVCVWVIMAVLSLPNIILT
NGQPTEDNIHDCSKLKSPLGVKWHTAVTYVNSCLFVAVLVILIGCYIAISRYIHKSSRQF
ISQSSRKRKHNQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL
FLSACNVCLDPIIYFFMCRSFSRRLFKKSNIRTRSESIRSLQSVRRSEVRIYYDYTDV
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggggttcaacttgacgcttgcaaaattaccaaataacgagctgcacggccaagagagt
cacaattcaggcaacaggagcgacgggccaggaaagaacaccacccttcacaatgaattt
gacacaattgtcttgccggtgctttatctcattatatttgtggcaagcatcttgctgaat
ggtttagcagtgtggatcttcttccacattaggaataaaaccagcttcatattctatctc
aaaaacatagtggttgcagacctcataatgacgctgacatttccatttcgaatagtccat
gatgcaggatttggaccttggtacttcaagtttattctctgcagatacacttcagttttg
ttttatgcaaacatgtatacttccatcgtgttccttgggctgataagcattgatcgctat
ctgaaggtggtcaagccatttggggactctcggatgtacagcataaccttcacgaaggtt
ttatctgtttgtgtttgggtgatcatggctgttttgtctttgccaaacatcatcctaaca
aatggtcagccaacagaggacaatatccatgactgctcaaaacttaaaagtcctttgggg
gtcaaatggcatacggcagtcacctatgtgaacagctgcttgtttgtggccgtgctggtg
attctgatcggatgttacatagccatatccaggtacatccacaaatccagcaggcaattc
ataagtcagtcaagccgaaagcgaaaacataaccagagcatcagggttgttgtggctgtg
ttttttacctgctttctaccatatcacttgtgcagaattccttttacttttagtcactta
gacaggcttttagatgaatctgcacaaaaaatcctatattactgcaaagaaattacactt
ttcttgtctgcgtgtaatgtttgcctggatccaataatttactttttcatgtgtaggtca
ttttcaagaaggctgttcaaaaaatcaaatatcagaaccaggagtgaaagcatcagatca
ctgcaaagtgtgagaagatcggaagttcgcatatattatgattacactgatgtgtag

DBGET integrated database retrieval system