KEGG   Homo sapiens (human): 53838
Entry
53838             CDS       T01001                                 
Symbol
C11orf24, DM4E3
Name
(RefSeq) chromosome 11 open reading frame 24
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF5585 PHB_acc_N
Other DBs
NCBI-GeneID: 53838
NCBI-ProteinID: NP_071733
OMIM: 610880
HGNC: 1174
Ensembl: ENSG00000171067
Pharos: Q96F05(Tdark)
UniProt: Q96F05 A0A024R5K9
Position
11:complement(68261338..68271973)
AA seq 449 aa
MWTALVLIWIFSLSLSESHAASNDPRNFVPNKMWKGLVKRNASVETVDNKTSEDVTMAAA
SPVTLTKGTSAAHLNSMEVTTEDTSRTDVSEPATSGGAADGVTSIAPTAVASSTTAASIT
TAASSMTVASSAPTTAASSTTVASIAPTTAASSMTAASSTPMTLALPAPTSTSTGRTPST
TATGHPSLSTALAQVPKSSALPRTATLATLATRAQTVATTANTSSPMSTRPSPSKHMPSD
TAASPVPPMRPQAQGPISQVSVDQPVVNTTNKSTPMPSNTTPEPAPTPTVVTTTKAQARE
PTASPVPVPHTSPIPEMEAMSPTTQPSPMPYTQRAAGPGTSQAPEQVETEATPGTDSTGP
TPRSSGGTKMPATDSCQPSTQGQYMVVTTEPLTQAVVDKTLLLVVLLLGVTLFITVLVLF
ALQAYESYKKKDYTQVDYLINGMYADSEM
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgtggacagctcttgtgctcatttggattttctccttgtccttatctgaaagccatgcg
gcatccaacgatccacgcaactttgtccctaacaaaatgtggaagggattagtcaagagg
aatgcatctgtggaaacagttgataataaaacgtctgaggatgtaaccatggcagcagct
tctcctgtcacattgaccaaagggacttcggcagcccacctcaactctatggaagtcaca
acagaggacacaagcaggacagatgtgagtgaaccagcaacttcaggaggtgcagctgat
ggtgtgacctccattgctcccacggctgtggcctccagtacgactgcggcctccattacg
actgcggcctccagtatgactgtggcctccagtgctcccacgactgcagcctccagtaca
actgtggcctccattgctcccacgactgcagcctccagtatgactgcggcctccagcact
cccatgacacttgcactccccgcgcccacgtccacttccacagggcggaccccgtccact
accgccactgggcatccatctctcagcacagccctcgcacaagtgccaaagagcagcgcg
ttgccaagaacagcaaccctggccacattggccacacgtgctcagactgtagcgaccaca
gcaaacacaagcagccccatgagcactcgtccaagtccttccaagcacatgcccagtgac
accgcggcaagccctgtaccccctatgcgtccccaagcacaaggtcccattagccaggtg
tcagtggaccagcctgtggttaacacaacaaataaatccacacccatgccctcaaacaca
accccagagcccgcccccacccccacagtggtgaccaccaccaaggcacaagccagggag
ccaactgccagcccagtgccagtacctcacaccagcccaatccctgagatggaggccatg
tcccccacgacacagccaagccccatgccatatacccagagggccgctgggccaggcaca
tcccaggcaccggagcaggtagagactgaagccacaccaggtactgattccactgggcca
acacccaggagctcagggggcactaagatgccagccacggactcgtgccagcccagcacc
caaggccagtacatggtggtcaccactgagcccctcacccaggccgtggtagacaaaact
ctccttctggtggtgctgttactcggggtgacccttttcatcacagtcttggttttgttt
gccctgcaggcctatgagagctacaagaagaaggactacacccaggtggactacttaatc
aacgggatgtatgcggactcagaaatgtga

DBGET integrated database retrieval system