KEGG   Homo sapiens (human): 53842Help
Entry
53842             CDS       T01001                                 

Gene name
CLDN22, CLDN21
Definition
(RefSeq) claudin 22
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    53842 (CLDN22)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    53842 (CLDN22)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    53842 (CLDN22)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    53842 (CLDN22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    53842 (CLDN22)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   53842 (CLDN22)
  Exosomal proteins of colorectal cancer cells
   53842 (CLDN22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 53842
NCBI-ProteinID: NP_001104789
HGNC: 2044
Ensembl: ENSG00000177300
Vega: OTTHUMG00000160627
Pharos: Q8N7P3(Tdark)
UniProt: Q8N7P3
Position
4q35.1
AA seq 220 aa AA seqDB search
MALVFRTVAQLAGVSLSLLGWVLSCLTNYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEV
GMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGESQRDLKRRLLI
LGGILSWASGVTALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGG
CLLHCAACSSHAPLASGHYAVAQTQDHHQELETRNTNLKH
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctttagtatttagaactgtagctcaactagctggagtttcattatctttgctggga
tgggttttatcctgtcttacaaactacctgccacactggaagaacctcaacctggactta
aatgaaatggaaaactggaccatgggactctggcaaacctgtgtcatccaagaggaagtg
gggatgcaatgcaaggactttgactccttcctggctttgcctgctgaactcagggtctcc
aggatcttaatgtttctgtcaaatgggctgggatttctgggcctgctggtctctgggttt
ggcctggactgtttgagaattggagagagtcagagagatctcaagaggcgactgctgatc
ctgggaggaattctgtcctgggcctcgggagtcacagccctggttcccgtctcttgggtt
gcccacaagacggttcaggagttctgggatgagaacgtcccagactttgtccccaggtgg
gagtttggggaggccctgtttctgggctggtttgctggactttctcttctgctaggaggg
tgtctgctccactgtgcagcctgctccagccacgctcccctagcttcgggccactacgca
gtggcacaaacacaagatcatcatcaagaactggagacgagaaacaccaacctgaaacac
taa

DBGET integrated database retrieval system