KEGG   Homo sapiens (human): 539
Entry
539               CDS       T01001                                 

Gene name
ATP5PO, ATP5O, ATPO, HMC08D05, OSCP
Definition
(RefSeq) ATP synthase peripheral stalk subunit OSCP
  KO
K02137  F-type H+-transporting ATPase subunit O
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    539 (ATP5PO)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    539 (ATP5PO)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    539 (ATP5PO)
   05012 Parkinson disease
    539 (ATP5PO)
   05014 Amyotrophic lateral sclerosis
    539 (ATP5PO)
   05016 Huntington disease
    539 (ATP5PO)
   05020 Prion disease
    539 (ATP5PO)
   05022 Pathways of neurodegeneration - multiple diseases
    539 (ATP5PO)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    539 (ATP5PO)
SSDB
Motif
Pfam: OSCP
Other DBs
NCBI-GeneID: 539
NCBI-ProteinID: NP_001688
OMIM: 600828
HGNC: 850
Ensembl: ENSG00000241837
Vega: OTTHUMG00000065186
Pharos: P48047(Tbio)
UniProt: P48047
Position
21q22.11
AA seq 213 aa
MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEK
ELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSN
TQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPS
ILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
NT seq 642 nt   +upstreamnt  +downstreamnt
atggctgccccagcagtgtccgggctctcccggcaggtgcgatgcttcagtacctctgtg
gtcagaccatttgccaagcttgtgaggcctcctgttcaggtatacggtattgaaggtcgc
tatgccacagctctttattctgctgcatcaaaacagaataagctggagcaagtagaaaag
gagttgttgagagtagcacaaatcctgaaggaacccaaagtggctgcttctgttttgaat
ccctatgtgaagcgttccattaaagtgaaaagcctaaatgacatcacagcaaaagagagg
ttctctcccctcactaccaatctgatcaatttgcttgctgaaaatggtcgattaagcaat
acccaaggagtcgtttctgccttttctaccatgatgagtgtccatcgcggagaggtacct
tgcacagtgacctctgcatctcctttagaagaagccacactctctgaattaaaaactgtc
ctcaagagcttcctaagtcaaggccaagtattgaaattggaggctaagactgatccgtca
atcttgggtggaatgattgtgcgcattggcgagaaatatgttgacatgtctgtcaagacc
aagattcagaagctgggcagggctatgcgggagattgtctaa

DBGET integrated database retrieval system