KEGG   Homo sapiens (human): 53916
Entry
53916             CDS       T01001                                 

Gene name
RAB4B
Definition
(RefSeq) RAB4B, member RAS oncogene family
  KO
K07880  Ras-related protein Rab-4B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    53916 (RAB4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    53916 (RAB4B)
   04031 GTP-binding proteins [BR:hsa04031]
    53916 (RAB4B)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    53916 (RAB4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   53916 (RAB4B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    53916 (RAB4B)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_7 AAA_16 SRPRB ATPase Septin UvrD-helicase AAA_22 ATPase_2
Other DBs
NCBI-GeneID: 53916
NCBI-ProteinID: NP_057238
OMIM: 612945
HGNC: 9782
Ensembl: ENSG00000167578
Vega: OTTHUMG00000182694
Pharos: P61018(Tdark)
UniProt: P61018 A0A024R0K8
Structure
PDB: 
2O52

Position
19q13.2
AA seq 213 aa
MAETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKTVKLQ
IWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCG
NKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIDSGELDP
ERMGSGIQYGDASLRQLRQPRSAQAVAPQPCGC
NT seq 642 nt   +upstreamnt  +downstreamnt
atggctgagacctacgacttcctcttcaaattcctggtgattggcagtgcaggaactggc
aaatcatgtctccttcatcagttcattgagaataagttcaaacaggactccaaccacaca
atcggcgtggagtttggatcccgggtggtcaacgtgggtgggaagactgtgaagctacag
atttgggacacggctggccaggagcggtttcggtcagtgacgcggagttattaccgaggg
gcggctggagccctgctggtgtacgacatcaccagccgggagacatacaactcactggct
gcctggctgacggatgcccgcaccctggccagccccaacatcgtggtcatcctctgtggc
aacaagaaggacctggaccctgagcgggaggtcactttcctggaggcctcccgctttgcc
caggagaatgagctgatgttcctggagaccagcgctctcacaggcgagaacgtggaggag
gcgttcctcaagtgtgcccgcactatcctcaacaagattgactcaggcgagctagacccg
gagaggatgggctctggcattcagtacggggatgcgtccctccgccagcttcggcagcct
cggagtgcccaggccgtggcccctcagccgtgtggctgctga

DBGET integrated database retrieval system