KEGG   Homo sapiens (human): 53918Help
Entry
53918             CDS       T01001                                 

Gene name
PELO, CGI-17, PRO1770
Definition
(RefSeq) pelota mRNA surveillance and ribosome rescue factor
  KO
K06965  protein pelota
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    53918 (PELO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eRF1_1 eRF1_2 eRF1_3
Motif
Other DBs
NCBI-GeneID: 53918
NCBI-ProteinID: NP_057030
OMIM: 605757
HGNC: 8829
Ensembl: ENSG00000152684
Vega: OTTHUMG00000096973
Pharos: Q9BRX2(Tbio)
UniProt: Q9BRX2
Structure
PDB: 

Position
5q11.2
AA seq 385 aa AA seqDB search
MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNR
VRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSV
VLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDR
ALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYLFQQAVKTDNKLLLENRSKF
LQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVE
KANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLT
GVAAILRFPVPELSDQEGDSSSEED
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgtgaggaagaacatcgagaaggacaatgcgggccaggtgaccctggtcccc
gaggagcctgaggacatgtggcacacttacaacctcgtgcaggtgggcgacagcctgcgc
gcctccaccatccgcaaggtacagacagagtcctccacgggcagcgtgggcagcaaccgg
gtccgcactaccctcactctctgcgtggaggccatcgacttcgactctcaagcctgccag
ctgcgggttaaggggaccaacatccaagagaatgagtatgtcaagatgggggcttaccac
accatcgagctggagcccaaccgccagttcaccctggccaagaagcagtgggatagtgtg
gtactggagcgcatcgagcaggcctgtgacccagcctggagcgctgatgtggcggctgtg
gtcatgcaggaaggcctcgcccatatctgcttagtcactcccagcatgaccctcactcgg
gccaaggtggaggtgaacatccctaggaaaaggaaaggcaattgctctcagcatgaccgg
gccttggagcggttctatgaacaggtggtccaggctatccagcgccacatacactttgat
gttgtaaagtgcatcctggtggccagcccaggatttgtgagggagcagttctgcgactac
ctgtttcaacaagcagtgaagaccgacaacaaactgctcctggaaaaccggtccaaattt
cttcaggtacatgcctcctccggacacaagtactccctgaaagaggccctttgtgaccct
actgtggctagccgcctttcagacactaaagctgctggggaagtcaaagccttggatgac
ttctataaaatgttacagcatgaaccggatcgagctttctatggactcaagcaggtggag
aaggccaatgaagccatggcaattgacacattgctcatcagcgatgagctcttcaggcat
caggatgtagccacacggagccggtatgtgaggctggtggacagtgtgaaagagaatgca
ggcaccgttaggatattctctagtcttcacgtttctggggaacagctcagccagttgact
ggggtagctgccattctccgcttccctgttcccgaactttctgaccaagagggtgattcc
agttctgaagaggattaa

DBGET integrated database retrieval system