KEGG   Homo sapiens (human): 53938
Entry
53938             CDS       T01001                                 
Symbol
PPIL3, CYPJ
Name
(RefSeq) peptidylprolyl isomerase like 3
  KO
K12734  peptidyl-prolyl cis-trans isomerase-like 3 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    53938 (PPIL3)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    53938 (PPIL3)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     53938 (PPIL3)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   PPlases
    53938 (PPIL3)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    53938 (PPIL3)
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 53938
NCBI-ProteinID: NP_570981
OMIM: 615811
HGNC: 9262
Ensembl: ENSG00000240344
Vega: OTTHUMG00000132782
Pharos: Q9H2H8(Tbio)
UniProt: Q9H2H8 A0A024R3V4
Structure
Position
2:complement(200870907..200889291)
AA seq 161 aa
MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTG
RGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGK
VIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtctgtgacactgcatacagatgtaggtgatattaaaattgaagtcttctgtgagagg
acacccaaaacatgtgagaatttcttggctctttgtgccagtaattactacaatggctgt
atatttcataggaatatcaagggtttcatggttcaaacaggagatccaacaggaactgga
agaggaggcaacagtatttggggcaagaagtttgaggatgaatacagtgaatatcttaag
cacaatgttagaggtgttgtatctatggctaataatggcccgaacaccaatggatctcag
ttcttcatcacctatggcaaacagccacatttggacatgaaatacaccgtatttggaaag
gtaatagatggtctggaaactctagatgagttggagaagttgccagtaaatgagaagaca
taccgacctcttaatgatgtacacattaaggacataactattcatgccaacccatttgct
cagtag

DBGET integrated database retrieval system