KEGG   Homo sapiens (human): 53940Help
Entry
53940             CDS       T01001                                 

Gene name
FTHL17, CT38
Definition
(RefSeq) ferritin heavy chain like 17
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ferritin
Motif
Other DBs
NCBI-GeneID: 53940
NCBI-ProteinID: NP_114100
OMIM: 300308
HGNC: 3987
Ensembl: ENSG00000132446
Vega: OTTHUMG00000021332
Pharos: Q9BXU8(Tdark)
UniProt: Q9BXU8 A0A384NPV7
Position
Xp21.2
AA seq 183 aa AA seqDB search
MATAQPSQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLS
DDKMEHAQKLMRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQ
LAVEKGDPQLCHFLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRV
KET
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgcccagccgtcgcaggtgcgccagaagtacgacaccaactgcgacgccgcc
atcaacagccacatcacgctggagctctacacctcctacctgtacctgtctatggccttc
tacttcaaccgggacgacgtggccctggagaacttcttccgctacttcctgcgcctgtcg
gacgacaaaatggagcatgcccagaagctgatgaggctgcagaacctgcgcggtggccac
atctgccttcacgatatcaggaagccagagtgccaaggctgggagagcgggctcgtggcc
atggagtccgccttccacctggagaagaacgtcaaccagagcctgctggatctgtaccag
ctggccgtggagaagggcgacccccagctgtgccacttcctggagagccactacctgcac
gagcaagtcaagaccatcaaagagctgggtggctacgtgagcaacctgcgcaagatttgt
tccccggaagccggcctggctgagtacctgttcgacaagctcaccctgggcggccgcgtc
aaagagacttga

DBGET integrated database retrieval system