KEGG   Homo sapiens (human): 53944Help
Entry
53944             CDS       T01001                                 

Gene name
CSNK1G1, CK1gamma1
Definition
(RefSeq) casein kinase 1 gamma 1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    53944 (CSNK1G1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    53944 (CSNK1G1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     53944 (CSNK1G1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   53944 (CSNK1G1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr CK1gamma_C Pkinase_fungal PIP49_C
Motif
Other DBs
NCBI-GeneID: 53944
NCBI-ProteinID: NP_001316535
OMIM: 606274
HGNC: 2454
Ensembl: ENSG00000169118
Vega: OTTHUMG00000133019
Pharos: Q9HCP0(Tbio)
UniProt: Q9HCP0 A0A024R5W3
Structure
PDB: 

Position
15q22.31
AA seq 422 aa AA seqDB search
MDHPSREKDERQRTTKPMAQRSAHCSRPSGSSSSSGVLMVGPNFRVGKKIGCGNFGELRL
GKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLEL
LGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKE
HVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHM
FMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFE
KPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRP
SQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKTAQR
HK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggaccatcctagtagggaaaaggatgaaagacaacggacaactaaacccatggcacaa
aggagtgcacactgctctcgaccatctggctcctcatcgtcctctggggttcttatggtg
ggacccaacttcagggttggcaagaagataggatgtgggaacttcggagagctcagatta
ggtaaaaatctctacaccaatgaatatgtagcaatcaaactggaaccaataaaatcacgt
gctccacagcttcatttagagtacagattttataaacagcttggcagtgcaggtgaaggt
ctcccacaggtgtattactttggaccatgtgggaaatataatgccatggtgctggagctc
cttggccctagcttggaggacttgtttgacctctgtgaccgaacatttactttgaagacg
gtgttaatgatagccatccagctgctttctcgaatggaatacgtgcactcaaagaacctc
atttaccgagatgtcaagccagagaacttcctgattggtcgacaaggcaataagaaagag
catgttatacacattatagactttggactggccaaggaatacattgaccccgaaaccaaa
aaacacataccttatagggaacacaaaagtttaactggaactgcaagatatatgtctatc
aacacgcatcttggcaaagagcaaagccggagagatgatttggaagccctaggccatatg
ttcatgtatttccttcgaggcagcctcccctggcaaggactcaaggctgacacattaaaa
gagagatatcaaaaaattggtgacaccaaaaggaatactcccattgaagctctctgtgag
aactttccagaggagatggcaacctaccttcgatatgtcaggcgactggacttctttgaa
aaacctgattatgagtatttacggaccctcttcacagacctctttgaaaagaaaggctac
acctttgactatgcctatgattgggttgggagacctattcctactccagtagggtcagtt
cacgtagattctggtgcatctgcaataactcgagaaagccacacacatagggatcggcca
tcacaacagcagcctcttcgaaatcaggtggttagctcaaccaatggagagctgaatgtt
gatgatcccacgggagcccactccaatgcaccaatcacagctcatgccgaggtggaggta
gtggaggaagctaagtgctgctgtttctttaagaggaaaaggaagaagactgctcagcgc
cacaagtga

DBGET integrated database retrieval system