KEGG   Homo sapiens (human): 54Help
Entry
54                CDS       T01001                                 

Gene name
ACP5, HPAP, TRACP5a, TRACP5b, TRAP, TrATPase
Definition
(RefSeq) acid phosphatase 5, tartrate resistant
  KO
K14379  tartrate-resistant acid phosphatase type 5 [EC:3.1.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00740  Riboflavin metabolism
hsa01100  Metabolic pathways
hsa04142  Lysosome
hsa04380  Osteoclast differentiation
hsa05323  Rheumatoid arthritis
Disease
H01576  Spondyloenchondrodysplasia with immune dysregulation (SPENCDI)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    54 (ACP5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    54 (ACP5)
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    54 (ACP5)
 09160 Human Diseases
  09162 Immune diseases
   05323 Rheumatoid arthritis
    54 (ACP5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     54 (ACP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos Metallophos_2 PhoD
Motif
Other DBs
NCBI-GeneID: 54
NCBI-ProteinID: NP_001104504
OMIM: 171640
HGNC: 124
Ensembl: ENSG00000102575
Vega: OTTHUMG00000182036
Pharos: P13686(Tbio)
UniProt: P13686 A0A024R7F8
Structure
PDB: 

Position
19p13.2
AA seq 325 aa AA seqDB search
MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQI
LGADFILSLGDNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ
IAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTLCGNSDDFLSQQPERPRDVKL
ARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLRPLLATYGVTAYLCGH
DHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLGGFAYVEISSK
EMTVTYIEASGKSLFKTRLPRRARP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggacatgtggacggcgctgctcatcctgcaagccttgttgctaccctccctggctgat
ggtgccacccctgccctgcgctttgtagccgtgggtgactggggaggggtccccaatgcc
ccattccacacggcccgggaaatggccaatgccaaggagatcgctcggactgtgcagatc
ctgggtgcagacttcatcctgtctctaggggacaatttttacttcactggtgtgcaagac
atcaatgacaagaggttccaggagacctttgaggacgtattctctgaccgctcccttcgc
aaagtgccctggtacgtgctagccggaaaccatgaccaccttggcaatgtctctgcccag
attgcatactctaagatctccaagcgctggaacttccccagccctttctaccgcctgcac
ttcaagatcccacagaccaatgtgtctgtggccatttttatgctggacacagtgacacta
tgtggcaactcagatgacttcctcagccagcagcctgagaggccccgagacgtgaagctg
gcccgcacacagctgtcctggctcaagaaacagctggcggcggccagggaggactacgtg
ctggtggctggccactaccccgtgtggtccatagccgagcacgggcctacccactgcctg
gtcaagcagctacggccactgctggccacatacggggtcactgcctacctgtgcggccac
gatcacaatctgcagtacctgcaagatgagaatggcgtgggctacgtgctgagtggggct
gggaatttcatggacccctcaaagcggcaccagcgcaaggtccccaacggctatctgcgc
ttccactatgggactgaagactcactgggtggctttgcctatgtggagatcagctccaaa
gagatgactgtcacttacatcgaggcctcgggcaagtccctctttaagaccaggctgccg
aggcgagccaggccctga

DBGET integrated database retrieval system