KEGG   Homo sapiens (human): 54020
Entry
54020             CDS       T01001                                 
Symbol
SLC37A1, G3PP
Name
(RefSeq) solute carrier family 37 member 1
  KO
K13783  MFS transporter, OPA family, solute carrier family 37 (glycerol-3-phosphate transporter), member 1/2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    54020 (SLC37A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC37: Sugar-phosphate/phosphate exchanger
   54020 (SLC37A1)
 Major facilitator superfamily (MFS)
  Phosphate and organophosphate transporters
   Organophosphate:Pi antiporter (OPA) family [TC:2.A.1.4]
    54020 (SLC37A1)
SSDB
Motif
Pfam: MFS_1 OATP
Other DBs
NCBI-GeneID: 54020
NCBI-ProteinID: NP_001307466
OMIM: 608094
HGNC: 11024
Ensembl: ENSG00000160190
Pharos: P57057(Tdark)
UniProt: P57057
Position
21:42499622..42581426
AA seq 533 aa
MARLPAGIRFIISFSRDQWYRAFIFILTFLLYASFHLSRKPISIVKGELHKYCTAWDEAD
VRFSSQNRKSGSAAPHQLPDNETDCGWAPFDKNNYQQLLGALDYSFLCAYAVGMYLSGII
GERLPIRYYLTFGMLASGAFTALFGLGYFYNIHSFGFYVVTQVINGLVQTTGWPSVVTCL
GNWFGKGRRGLIMGVWNSHTSVGNILGSLIAGYWVSTCWGLSFVVPGAIVAAMGIVCFLF
LIEHPNDVRCSSTLVTHSKGYENGTNRLRLQKQILKSEKNKPLDPEMQCLLLSDGKGSIH
PNHVVILPGDGGSGTAAISFTGALKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHL
DAKKAGELSTLFDVGGIFGGILAGVISDRLEKRASTCGLMLLLAAPTLYIFSTVSKMGLE
ATIAMLLLSGALVSGPYTLITTAVSADLGTHKSLKGNAHALSTVTAIIDGTGSVGAALGP
LLAGLLSPSGWSNVFYMLMFADACALLFLIRLIHKELSCPGSATGDQVPFKEQ
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggctcgactccccgctggcattcgcttcatcatctcattctccagggatcagtggtac
agagccttcatttttattttgacatttctgctgtatgcaagttttcacttatctcgaaag
cctatcagcatagttaagggtgagctccacaagtactgcactgcttgggatgaagctgac
gtcaggttcagcagccagaacaggaagtctgggtccgctgccccccaccagctccctgac
aatgagaccgactgtggctgggcaccgtttgataagaacaactatcagcagctgcttggg
gccctggactactccttcctgtgcgcctatgccgtggggatgtacctcagtggcatcatt
ggggagcgcctgccgattaggtattacctaactttcgggatgctcgccagcggagccttc
accgccctgttcggcttagggtatttctacaacatccacagtttcggattctacgtggta
actcaggtcatcaacgggctggtgcagaccaccggctggcccagcgtcgtcacctgcctc
ggcaactggtttggaaaaggaaggagaggtttgattatgggggtctggaactcccacacc
tccgtgggcaacatcttggggtcattgatcgctggctactgggtgtccacatgctggggc
ctgtccttcgtcgtgcctggagccatcgtggcagccatggggatagtgtgctttctcttc
ctcattgaacatccgaacgacgtcaggtgctcctccaccctggtgacgcactcaaaaggc
tatgagaatggtacaaacagattgagactccagaagcaaatcttgaagagcgaaaagaac
aagcctctggacccagagatgcagtgcctgctgctctcagatgggaagggctccatccac
ccgaaccacgtcgtcattctccccggggacggtgggagtggcacggccgccatcagcttc
acaggggccttgaaaattccaggcgtgatagagttctcactgtgtctgctgtttgccaag
ctggtcagctatactttcctcttctggctgcccctgtacatcacgaatgtggatcacctt
gatgccaaaaaggcgggggagctctccaccctgtttgacgtgggcggaatctttggtggg
atcctggcaggtgtgatctcagaccgactggagaaaagggcctccacctgcggcctgatg
ctgctgctcgcggcccccacgctctacatcttctccaccgtcagcaagatggggcttgag
gccaccatcgccatgctgctgctcagcggagccctggtcagtgggccctacacactcatc
accaccgccgtctccgccgacctggggactcataaaagtctgaaaggcaacgcgcacgcc
ctctccaccgtgacggccatcattgacgggacgggctctgtaggagcagccctgggcccc
ctgctggctgggctcctctccccgtccggctggagcaatgtgttttacatgctgatgttt
gcagatgcctgtgccttactgttcctgatccgcctcatacacaaggagctgagctgccca
gggtcagctacgggggaccaagttccatttaaggaacagtga

DBGET integrated database retrieval system