KEGG   Homo sapiens (human): 54058
Entry
54058             CDS       T01001                                 
Symbol
C21orf58
Name
(RefSeq) chromosome 21 open reading frame 58
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4587
Other DBs
NCBI-GeneID: 54058
NCBI-ProteinID: NP_478060
HGNC: 1300
Ensembl: ENSG00000160298
Pharos: P58505(Tdark)
UniProt: P58505
Position
21:complement(46300430..46323870)
AA seq 322 aa
MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAWAPAEQFFPAS
NRTREGGGLWPPLPLQSSPAAPTMLDSSAAEQVTRLTLKLLGQKLEQERQNVEGGPEGLH
LEPGNEDRPDDALQTALKRRRDLLQRLREQHLLDELSRAQAWSGPSRGALGSALPPELPP
TGILPTASPSPLAPDPPRIILPTVPQPPATIIQQLPQQPLIAQIPPPQAFPTQRSGSIKE
DMVELLLLQNAQVHQLVLQNWMLKALPPALQDPPHVPPRVPRAARPRLPAVHHHHHHHHA
VWPPGAATVLQPAPSLWTPGPP
NT seq 969 nt   +upstreamnt  +downstreamnt
atggcgcgatctcggctccctgcaacctccctcaggaagccgtggaagctcgaccgccag
aaacttccttctcctgactcaggccacagtcttctgtgtggctggtctccaggaggtaag
gcccgccctgcaggcaacaccggtgcttgggctcctgctgagcagttctttcctgcgagt
aacagaaccagggagggaggtgggctgtggcctcccctgcccctacagtcgtctcctgca
gctcccaccatgctggactcatcagcagcagagcaagtgacccgactgacgctgaagctc
ttgggacagaagctggagcaagaacggcagaacgtggaagggggacctgagggcctccac
ctcgagccaggaaatgaggaccggccggacgatgccctgcagactgctctgaagagaagg
agggaccttctgcagagactccgggaacaacacctcctggacgagctctctcgggcccag
gcctggagcgggccaagcagaggagccctcgggtcagccctgcccccagagctgcccccc
acgggcatcctacccactgcctccccatccccgctggccccagacccgccaaggatcatc
ctgcctacggtcccccagcctcctgccaccatcattcagcagctccctcagcagccactc
atagcacagattcctcctccccaggccttccctactcaacggtcaggaagtattaaggaa
gacatggtggagctgctgctgctgcagaacgcacaggtgcaccagttggtcctgcagaac
tggatgctcaaggccctgcccccagccctgcaggacccgccacatgtgcccccgagggtc
ccacgagctgccaggccaaggctgcctgccgtgcaccaccaccaccaccaccaccatgct
gtgtggccacctggggctgccactgtcctccagcccgcccccagcctgtggacgcctggc
ccaccctga

DBGET integrated database retrieval system