KEGG   Homo sapiens (human): 5406Help
Entry
5406              CDS       T01001                                 

Gene name
PNLIP, PL, PNLIPD, PTL
Definition
(RefSeq) pancreatic lipase
  KO
K14073  pancreatic triacylglycerol lipase [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
hsa04977  Vitamin digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Drug target
Cetilistat: D09208
Orlistat: D04028
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    5406 (PNLIP)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    5406 (PNLIP)
   04975 Fat digestion and absorption
    5406 (PNLIP)
   04977 Vitamin digestion and absorption
    5406 (PNLIP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     5406 (PNLIP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_6 Hydrolase_4 Abhydrolase_1 DUF900
Motif
Other DBs
NCBI-GeneID: 5406
NCBI-ProteinID: NP_000927
OMIM: 246600
HGNC: 9155
Ensembl: ENSG00000175535
Vega: OTTHUMG00000019103
Pharos: P16233(Tclin)
UniProt: P16233
Structure
PDB: 

Position
10q25.3
AA seq 465 aa AA seqDB search
MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC
VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR
RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH
LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF
PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS
VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY
NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctgccactttggactctttcactgctgctgggagcagtagcaggaaaagaagtttgc
tacgaaagactcggctgcttcagtgatgactccccatggtcaggaattacggaaagaccc
ctccatatattgccttggtctccaaaagatgtcaacacccgcttcctcctatatactaat
gagaacccaaacaactttcaagaagttgccgcagattcatcaagcatcagtggctccaat
ttcaaaacaaatagaaaaactcgctttattattcatggattcatagacaagggagaagaa
aactggctggccaatgtgtgcaagaatctgttcaaggtggaaagtgtgaactgtatctgt
gtggactggaaaggtggctcccgaactggatacacacaagcctcgcagaacatcaggatc
gtgggagcagaagtggcatattttgttgaatttcttcagtcggcgttcggttactcacct
tccaacgtgcatgtcattggccacagcctgggtgcccacgctgctggggaggctggaagg
agaaccaatgggaccattggacgcatcacagggttggacccagcagaaccttgctttcag
ggcacacctgaattagtccgattggaccccagcgatgccaaatttgtggatgtaattcac
acggatggtgcccccatagtccccaatttggggtttggaatgagccaagtcgtgggccac
ctagatttctttccaaatggaggagtggaaatgcctggatgtaaaaagaacattctctct
cagattgtggacatagacggaatctgggaagggactcgagactttgcggcctgtaatcac
ttaagaagctacaaatattacactgatagcatcgtcaaccctgatggctttgctggattc
ccctgtgcctcttacaacgtcttcactgcaaacaagtgtttcccttgtccaagtggaggc
tgcccacagatgggtcactatgctgatagatatcctgggaaaacaaatgatgtgggccag
aaattttatctagacactggtgatgccagtaattttgcacgttggaggtataaggtatct
gtcacactgtctggaaaaaaggttacaggacacatactagtttctttgttcggaaataaa
ggaaactctaagcagtatgaaattttcaagggcactctcaaaccagatagtactcattcc
aatgaatttgactcagatgtggatgttggggacttgcagatggttaaatttatttggtat
aacaatgtgatcaacccaactttacctagagtgggagcatccaagattatagtggagaca
aatgttggaaaacagttcaacttctgtagtccagaaaccgtcagggaggaagttctgctc
accctcacaccgtgttag

DBGET integrated database retrieval system