KEGG   Homo sapiens (human): 54069
Entry
54069             CDS       T01001                                 

Gene name
MIS18A, B28, C21orf45, C21orf46, FASP1, MIS18alpha, hMis18alpha
Definition
(RefSeq) MIS18 kinetochore protein A
  KO
K11564  kinetochore protein Mis18
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54069 (MIS18A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    MIS16-MIS18 complex
     54069 (MIS18A)
SSDB
Motif
Pfam: Yippee-Mis18
Other DBs
NCBI-GeneID: 54069
NCBI-ProteinID: NP_061817
OMIM: 618137
HGNC: 1286
Ensembl: ENSG00000159055
Vega: OTTHUMG00000085308
Pharos: Q9NYP9(Tdark)
UniProt: Q9NYP9
Position
21q22.11
AA seq 233 aa
MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDAS
VADMERAQLEEEAAAAEERPLVFLCSGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVD
KEQKLSKREKENGCVLETLCCAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGS
SEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATCKS
NT seq 702 nt   +upstreamnt  +downstreamnt
atggcaggcgttcggtcactgaggtgtagcagaggatgcgctggcggctgtgagtgcggc
gacaagggcaaatgcagcgactcctcgctgttgggcaagagactctccgaagactcgagc
cgccaccagctgttgcagaagtgggcgagcatgtggagctccatgagcgaagacgcgtcg
gtggccgacatggagagggcgcagctggaggaggaggcggcggctgcggaggagaggccg
ctggtgttcctgtgctccggctgccggcggccgctgggcgactcgctgagctgggtggcc
agccaggaggacaccaactgcatcctgcttcgctgtgtttcctgtaatgtttctgtggat
aaggaacagaagctatccaaacgtgaaaaggaaaatggttgcgtccttgagactttgtgc
tgcgcggggtgctcactcaatcttggctacgtgtacagatgcacgcccaagaatcttgat
tacaagagagacttgttttgcctcagtgttgaagccattgaaagttatgttttagggtcc
tctgaaaagcaaattgtgtcagaagataaagagctttttaatcttgaaagcagagttgaa
atagaaaagtctctaacacagatggaagatgtcttgaaagcattacaaatgaagctgtgg
gaggccgaatccaaattgtcctttgccacttgtaaaagctga

DBGET integrated database retrieval system