KEGG   Homo sapiens (human): 54084Help
Entry
54084             CDS       T01001                                 

Gene name
TSPEAR, C21orf29, DFNB98, ECTD14, TSP-EAR
Definition
(RefSeq) thrombospondin type laminin G domain and EAR repeats
Organism
hsa  Homo sapiens (human)
Disease
H00605  Deafness, autosomal recessive
SSDB OrthologParalogGFIT
Motif
Pfam: EPTP
Motif
Other DBs
NCBI-GeneID: 54084
NCBI-ProteinID: NP_659428
OMIM: 612920
HGNC: 1268
Ensembl: ENSG00000175894
Vega: OTTHUMG00000041215
Pharos: Q8WU66(Tbio)
UniProt: Q8WU66
Position
21q22.3
AA seq 669 aa AA seqDB search
MSALLSLCFVLPLAAPGHGTQGWEPCTDLRPLDILAEVVPSDGATSGIRIVQVHGARGLQ
LSVAAPRTMSFPASRIFSQCDLFPEEFSIVVTLRVPNLPPKRNEYLLTVVAEESDLLLLG
LRLSPAQLHFLFLREDTAGAWQTRVSFRSPALVDGRWHTLVLAVSAGVFSLTTDCGLPVD
IMADVPFPATLSVKGARFFVGSRRRAKGLFMGLVRQLVLLPGSDATPRLCPSRNAPLAVL
SIPRVLQALTGKPEDNEVLKYPYETNIRVTLGPQPPCTEVEDAQFWFDASRKGLYLCVGN
EWVSVLAAKERLDYVEEHQNLSTNSETLGIEVFRIPQVGLFVATANRKATSAVYKWTEEK
FVSYQNIPTHQAQAWRHFTIGKKIFLAVANFEPDEKGQEFSVIYKWSHRKLKFTPYQSIA
THSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWE
FFSVGPYSFLVVANTFNGTSTKVHSHLYIRLLGSFQLFQSFPTFGAADWEVFQIGERIFL
AVANSHSYDVEMQVQNDSYVINSVIYELNVTAQAFVKFQDILTCSALDWEFFSVGEDYFL
VVANSFDGRTFSVNSIIYRWQGYEGFVAVHSLPTVGCRDWEAFSTTAGAYLIYSSAKEPL
SRVLRLRTR
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccctgctgagtctgtgttttgtgctgcccctggcggcccccggccacggcacg
cagggttgggagccctgcacagacctgcgccccctggacatcctggcggaagtggtccct
tctgatggcgccacaagcgggatcaggatagttcaggttcacggtgcacggggactccag
ctctcagtagccgccccccgcaccatgagcttcccagcatccaggattttctcccagtgt
gacctcttccctgaagaattttccatcgtcgtaactttgagagttcccaatcttccaccc
aagaggaacgagtacctgctgacggtggtggcagaggagagcgacctgctgctgctcggc
ctgcggttgtcacctgcccagctgcacttcctgttccttcgcgaggacacggccggcgcc
tggcagacccgagtgtccttccgcagcccggccctggtggatggccgctggcacacactg
gtcctggctgtgtccgcaggcgtcttctccctcaccacggactgcggcctcccggtggac
ataatggccgatgtgcccttcccagccaccctgtcagtgaaaggagctcgattcttcgtc
ggcagccggaggagagccaaaggcctgttcatgggactggtgaggcaactggtcctgctg
ccgggctcagacgccaccccaaggctgtgtcccagcaggaacgccccgctggcggtgctg
tccatcccacgggtcctgcaggctctcacggggaagccagaagataacgaggtgctaaaa
tatccctatgaaaccaacattcgagtgacgctgggaccccagccaccgtgtaccgaggtg
gaagacgcccagttctggtttgatgccagccggaagggcctgtatctgtgtgttggcaac
gagtgggtctccgtgttagcagccaaagaaagactggactacgtggaggagcatcagaac
ttgtccaccaactcagagaccctgggcattgaggtgttccgcatccctcaggtggggctc
tttgtggccacagccaatcgcaaagccacatccgccgtctacaagtggaccgaagagaag
ttcgtctcatatcagaacatccccacgcaccaagcacaggcctggaggcatttcaccatc
gggaaaaagatcttcctggcagtggctaattttgaaccagatgagaagggtcaggagttc
tctgtcatttacaaatggagccacagaaagctgaagtttaccccatatcagagcattgcc
acacacagcgcccgagactgggaggccttcgaggtggatggggagcacttcctggcggtg
gccaaccaccgggaaggcgacaaccacaacatcgacagtgtcatctacaagtggaacccg
gcaacccggctcttcgaggccaaccagaccatcgccacctccggcgcctacgactgggag
ttcttcagtgtggggccctactcgttcctggtggtggccaacaccttcaacggcacctcc
accaaggtgcactcgcacctctacatccgactcctgggctccttccagctcttccagtcc
ttcccgacgttcggtgctgcagactgggaggtcttccagatcggggagaggatcttcctc
gctgtggcaaacagtcacagctacgatgtggagatgcaagtccagaatgattcctatgtc
atcaactccgtcatctacgagctgaacgtgaccgcgcaggcctttgtcaagttccaggac
attctcacctgcagtgctctggactgggagtttttctcggtgggagaagattatttcctg
gtggtggccaactccttcgatgggcgtaccttctcggtgaacagtattatttacaggtgg
cagggctacgagggcttcgtggcggtgcacagcctccccaccgtcggctgcagggactgg
gaggccttcagcaccacggctggtgcctacctcatctactccagcgccaaggagcccctc
tccagggtcctgcggctgaggacacgctga

DBGET integrated database retrieval system