KEGG   Homo sapiens (human): 54102
Entry
54102             CDS       T01001                                 

Symbol
CLIC6, CLIC1L
Name
(RefSeq) chloride intracellular channel 6
  KO
K05026  chloride intracellular channel protein 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    54102 (CLIC6)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel, intracellular (CLIC)
   54102 (CLIC6)
SSDB
Motif
Pfam: GST_C_2 GST_N_2 GST_N_3 GST_C GST_C_3
Other DBs
NCBI-GeneID: 54102
NCBI-ProteinID: NP_001303938
OMIM: 615321
HGNC: 2065
Ensembl: ENSG00000159212
Vega: OTTHUMG00000086237
Pharos: Q96NY7(Tbio)
UniProt: Q96NY7
Position
21q22.12
AA seq 704 aa
MAEAAEPEGVAPGPQGPPEVPAPLAERPGEPGAAGGEAEGPEGSEGAEEAPRGAAAVKEA
GGGGPDRGPEAEARGTRGAHGETEAEEGAPEGAEVPQGGEETSGAQQVEGASPGRGAQGE
PRGEAQREPEDSAAPERQEEAEQRPEVPEGSASGEAGDSVDAEGPLGDNIEAEGPAGDSV
EAEGRVGDSVDAEGPAGDSVDAEGPLGDNIQAEGPAGDSVDAEGRVGDSVDAEGPAGDSV
DAEGRVGDSVEAGDPAGDGVEAGVPAGDSVEAEGPAGDSMDAEGPAGRARRVSGEPQQSG
DGSLSPQAEAIEVAAGESAGRSPGELAWDAAEEAEVPGVKGSEEAAPGDARADAGEDRVG
DGPQQEPGEDEERRERSPEGPREEEAAGGEEESPDSSPHGEASRGAAEPEAQLSNHLAEE
GPAEGSGEAARVNGRREDGEASEPRALGQEHDITLFVKVKLTALGCSRIAIKKYLRAGYD
GESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDV
NKIEEFLEEKLAPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIHEKNLLKAL
RKLDNYLNSPLPDEIDAYSTEDVTVSGRKFLDGDELTLADCNLLPKLHIIKIVAKKYRDF
EFPSEMTGIWRYLNNAYARDEFTNTCPADQEIEHAYSDVAKRMK
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggccgaggccgcggagccggagggggttgccccgggtccccaggggccgccggaggtc
cccgcgcctctggctgagagacccggagagccaggagccgcgggcggggaggcagaaggg
ccggaggggagcgagggcgcagaggaggcgccgaggggcgccgccgctgtgaaggaggca
ggaggcggcgggccagacaggggcccggaggccgaggcgcggggcacgaggggggcgcac
ggcgagactgaggccgaggagggagccccggagggtgccgaggtgccccaaggaggggag
gagacaagcggcgcgcagcaggtggagggggcgagcccgggacgcggcgcgcagggcgag
ccccgcggggaggctcagagggagcccgaggactctgcggcccccgagaggcaggaggag
gcggagcagaggcctgaggtcccggaaggtagcgcgtccggggaggcgggggacagcgta
gacgcggagggcccgctgggggacaacatagaagcggagggcccggcgggcgacagcgta
gaggcggagggccgggtgggggacagcgtagacgcggaaggtccggcgggggacagcgta
gacgcggagggcccgctgggggacaacatacaagccgagggcccggcgggggacagcgta
gacgcggagggccgggtgggggacagcgtagacgcggaaggtccggcgggggacagcgta
gacgcggagggccgggtgggggacagcgtagaggcgggggacccggcgggggacggcgta
gaagcgggggtcccggcgggggacagcgtagaagccgaaggcccggcgggggacagcatg
gacgccgagggtccggcaggaagggcgcgccgggtctcgggtgagccgcagcaatcgggg
gacggcagcctctcgccccaggccgaggcaattgaggtcgcagccggggagagtgcgggg
cgcagccccggtgagctcgcctgggacgcagcggaggaggcggaggtcccgggggtaaag
gggtccgaagaagcggcccccggggacgcaagggcagacgctggcgaggacagggtaggg
gatgggccacagcaggagccgggggaggacgaagagagacgagagcggagcccggagggg
ccaagggaggaggaagcagcggggggcgaagaggaatcccccgacagcagcccacatggg
gaggcctccaggggcgccgcggagcctgaggcccagctcagcaaccacctggccgaggag
ggccccgccgagggtagcggcgaggccgcgcgcgtgaacggccgccgggaggacggagag
gcgtccgagccccgggccctggggcaggagcacgacatcaccctcttcgtcaaggtaaaa
cttactgcattaggctgttctcgcattgctataaagaaatacctgagagctggttatgat
ggtgagagtatcggaaattgcccgttttctcagcgtctctttatgattctctggctgaaa
ggcgttatatttaatgtgaccacagtggacctgaaaaggaaacccgcagacctgcagaac
ctggctcccggaacaaaccctcctttcatgacttttgatggtgaagtcaagacggatgtg
aataagatcgaggagttcttagaggagaaattagctcccccgaggtatcccaagctgggg
acccaacatcccgaatctaattccgcaggaaatgacgtgtttgccaaattctcagcgttt
ataaaaaacacgaagaaggatgcaaatgagattcatgaaaagaacctgctgaaggccctg
aggaagctggataattacttaaatagccctctgcctgatgaaatagatgcctacagcacc
gaggatgtcactgtttctggaaggaagtttctggatggggacgagctgacgctggctgac
tgcaacctcttacccaagctccatattattaagattgtggccaagaagtacagagatttt
gaatttccttctgaaatgactggcatctggagatacttgaataatgcttatgctagagat
gagttcacaaatacgtgtccagctgatcaagagattgaacacgcatattcagatgttgca
aaaagaatgaaatga

DBGET integrated database retrieval system