KEGG   Homo sapiens (human): 54106Help
Entry
54106             CDS       T01001                                 

Gene name
TLR9, CD289
Definition
(RefSeq) toll like receptor 9
  KO
K10161  toll-like receptor 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05152  Tuberculosis
hsa05162  Measles
hsa05168  Herpes simplex infection
Disease
H01358  Atopic dermatitis
Drug target
Agatolimod (DG01428): D08841 D08842
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    54106 (TLR9)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    54106 (TLR9)
   05162 Measles
    54106 (TLR9)
   05168 Herpes simplex infection
    54106 (TLR9)
   05144 Malaria
    54106 (TLR9)
   05142 Chagas disease (American trypanosomiasis)
    54106 (TLR9)
   05143 African trypanosomiasis
    54106 (TLR9)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   54106 (TLR9)
CD molecules [BR:hsa04090]
 Proteins
  54106 (TLR9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_9 TIR LRR_5 FNIP
Motif
Other DBs
NCBI-GeneID: 54106
NCBI-ProteinID: NP_059138
OMIM: 605474
HGNC: 15633
Ensembl: ENSG00000239732
Vega: OTTHUMG00000158106
Pharos: Q9NR96(Tclin)
UniProt: Q9NR96
Position
3p21.2
AA seq 1032 aa AA seqDB search
MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctgccgcagcgccctgcacccgctgtctctcctggtgcaggccatcatgctg
gccatgaccctggccctgggtaccttgcctgccttcctaccctgtgagctccagccccac
ggcctggtgaactgcaactggctgttcctgaagtctgtgccccacttctccatggcagca
ccccgtggcaatgtcaccagcctttccttgtcctccaaccgcatccaccacctccatgat
tctgactttgcccacctgcccagcctgcggcatctcaacctcaagtggaactgcccgccg
gttggcctcagccccatgcacttcccctgccacatgaccatcgagcccagcaccttcttg
gctgtgcccaccctggaagagctaaacctgagctacaacaacatcatgactgtgcctgcg
ctgcccaaatccctcatatccctgtccctcagccataccaacatcctgatgctagactct
gccagcctcgccggcctgcatgccctgcgcttcctattcatggacggcaactgttattac
aagaacccctgcaggcaggcactggaggtggccccgggtgccctccttggcctgggcaac
ctcacccacctgtcactcaagtacaacaacctcactgtggtgccccgcaacctgccttcc
agcctggagtatctgctgttgtcctacaaccgcatcgtcaaactggcgcctgaggacctg
gccaatctgaccgccctgcgtgtgctcgatgtgggcggaaattgccgccgctgcgaccac
gctcccaacccctgcatggagtgccctcgtcacttcccccagctacatcccgataccttc
agccacctgagccgtcttgaaggcctggtgttgaaggacagttctctctcctggctgaat
gccagttggttccgtgggctgggaaacctccgagtgctggacctgagtgagaacttcctc
tacaaatgcatcactaaaaccaaggccttccagggcctaacacagctgcgcaagcttaac
ctgtccttcaattaccaaaagagggtgtcctttgcccacctgtctctggccccttccttc
gggagcctggtcgccctgaaggagctggacatgcacggcatcttcttccgctcactcgat
gagaccacgctccggccactggcccgcctgcccatgctccagactctgcgtctgcagatg
aacttcatcaaccaggcccagctcggcatcttcagggccttccctggcctgcgctacgtg
gacctgtcggacaaccgcatcagcggagcttcggagctgacagccaccatgggggaggca
gatggaggggagaaggtctggctgcagcctggggaccttgctccggccccagtggacact
cccagctctgaagacttcaggcccaactgcagcaccctcaacttcaccttggatctgtca
cggaacaacctggtgaccgtgcagccggagatgtttgcccagctctcgcacctgcagtgc
ctgcgcctgagccacaactgcatctcgcaggcagtcaatggctcccagttcctgccgctg
accggtctgcaggtgctagacctgtcccacaataagctggacctctaccacgagcactca
ttcacggagctaccgcgactggaggccctggacctcagctacaacagccagccctttggc
atgcagggcgtgggccacaacttcagcttcgtggctcacctgcgcaccctgcgccacctc
agcctggcccacaacaacatccacagccaagtgtcccagcagctctgcagtacgtcgctg
cgggccctggacttcagcggcaatgcactgggccatatgtgggccgagggagacctctat
ctgcacttcttccaaggcctgagcggtttgatctggctggacttgtcccagaaccgcctg
cacaccctcctgccccaaaccctgcgcaacctccccaagagcctacaggtgctgcgtctc
cgtgacaattacctggccttctttaagtggtggagcctccacttcctgcccaaactggaa
gtcctcgacctggcaggaaaccagctgaaggccctgaccaatggcagcctgcctgctggc
acccggctccggaggctggatgtcagctgcaacagcatcagcttcgtggcccccggcttc
ttttccaaggccaaggagctgcgagagctcaaccttagcgccaacgccctcaagacagtg
gaccactcctggtttgggcccctggcgagtgccctgcaaatactagatgtaagcgccaac
cctctgcactgcgcctgtggggcggcctttatggacttcctgctggaggtgcaggctgcc
gtgcccggtctgcccagccgggtgaagtgtggcagtccgggccagctccagggcctcagc
atctttgcacaggacctgcgcctctgcctggatgaggccctctcctgggactgtttcgcc
ctctcgctgctggctgtggctctgggcctgggtgtgcccatgctgcatcacctctgtggc
tgggacctctggtactgcttccacctgtgcctggcctggcttccctggcgggggcggcaa
agtgggcgagatgaggatgccctgccctacgatgccttcgtggtcttcgacaaaacgcag
agcgcagtggcagactgggtgtacaacgagcttcgggggcagctggaggagtgccgtggg
cgctgggcactccgcctgtgcctggaggaacgcgactggctgcctggcaaaaccctcttt
gagaacctgtgggcctcggtctatggcagccgcaagacgctgtttgtgctggcccacacg
gaccgggtcagtggtctcttgcgcgccagcttcctgctggcccagcagcgcctgctggag
gaccgcaaggacgtcgtggtgctggtgatcctgagccctgacggccgccgctcccgctac
gtgcggctgcgccagcgcctctgccgccagagtgtcctcctctggccccaccagcccagt
ggtcagcgcagcttctgggcccagctgggcatggccctgaccagggacaaccaccacttc
tataaccggaacttctgccagggacccacggccgaatag

DBGET integrated database retrieval system