KEGG   Homo sapiens (human): 5413Help
Entry
5413              CDS       T01001                                 

Gene name
SEPTIN5, CDCREL, CDCREL-1, CDCREL1, H5, HCDCREL-1, PNUTL1, SEPT5
Definition
(RefSeq) septin 5
  KO
K04557  septin 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    5413 (SEPTIN5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5413 (SEPTIN5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    5413 (SEPTIN5)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    5413 (SEPTIN5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     5413 (SEPTIN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase GTP_EFTU Roc Ras AAA_16 AAA_29 AAA_22 NACHT ABC_tran
Motif
Other DBs
NCBI-GeneID: 5413
NCBI-ProteinID: NP_002679
OMIM: 602724
HGNC: 9164
Ensembl: ENSG00000184702
Vega: OTTHUMG00000150399
Pharos: Q99719(Tbio)
UniProt: Q99719 X5DNA9
Position
22q11.21
AA seq 369 aa AA seqDB search
MSTGLRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTL
VHSLFLTDLYKDRKLLSAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTE
CWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHE
KVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPECDSDEDEDFKQQDRELKE
SAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTC
DVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDAETEKLIRMKDEELRRMQEMLQ
RMKQQMQDQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaggcctgcggtacaagagcaagctggcgaccccagaggacaagcaggacatt
gacaagcagtacgtgggcttcgccacactgcccaaccaggtgcaccgcaagtcggtgaag
aaaggctttgacttcacactcatggtggctggtgagtcaggcctggggaagtccacactg
gtccacagcctcttcctgacagacttgtacaaggaccggaagctgctcagtgctgaggag
cgcatcagccagacggtagagattctaaaacacacggtggacattgaggagaagggagtc
aagctgaagctcaccatcgtggacacgccgggattcggggacgctgtcaacaacaccgag
tgctggaagcccatcaccgactatgtggaccagcagtttgagcagtacttccgtgatgag
agcggcctcaaccgaaagaacatccaagacaaccgagtgcactgctgcctatacttcatc
tcccccttcgggcatgggctgcggccagtggatgtgggtttcatgaaggcattgcatgag
aaggtcaacatcgtgcctctcatcgccaaagctgactgtcttgtccccagtgagatccgg
aagctgaaggagcggatccgggaggagattgacaagtttgggatccatgtataccagttc
cctgagtgtgactcggacgaggatgaggacttcaagcagcaggaccgggaactgaaggag
agcgcgcccttcgccgttataggcagcaacacggtggtggaggccaaggggcagcgggtc
cggggccgactgtacccctgggggatcgtggaggtggagaaccaggcgcattgcgacttc
gtgaagctgcgcaacatgctcatccgcacgcatatgcacgacctcaaggacgtgacgtgc
gacgtgcactacgagaactaccgcgcgcactgcatccagcagatgaccagcaaactgacc
caggacagccgcatggagagccccatcccgatcctgccgctgcccaccccggacgccgag
actgagaagcttatcaggatgaaggatgaggaactgaggcgcatgcaggagatgctgcag
aggatgaagcagcagatgcaggaccagtga

DBGET integrated database retrieval system