KEGG   Homo sapiens (human): 5414
Entry
5414              CDS       T01001                                 

Gene name
SEPTIN4, ARTS, BRADEION, C17orf47, CE5B3, H5, MART, PNUTL2, SEP4, SEPT4, hCDCREL-2, hucep-7
Definition
(RefSeq) septin 4
  KO
K16943  septin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    5414 (SEPTIN4)
   04215 Apoptosis - multiple species
    5414 (SEPTIN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5414 (SEPTIN4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    5414 (SEPTIN4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    5414 (SEPTIN4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     5414 (SEPTIN4)
SSDB
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase GTP_EFTU AIG1 VirE AAA_23 AAA_16 AAA_22 Ras AAA_29 ABC_tran Roc
Other DBs
NCBI-GeneID: 5414
NCBI-ProteinID: NP_004565
OMIM: 603696
HGNC: 9165
Ensembl: ENSG00000108387
Vega: OTTHUMG00000179243
Pharos: O43236(Tbio)
UniProt: O43236
Position
17q22
AA seq 478 aa
MDRSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQ
VPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSED
DKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEE
RIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDE
SGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVD
HKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEARGRRV
RGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVV
KERNRNKLTRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKENY
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggaccgttcactgggatggcaagggaattctgtccctgaggacaggactgaagctggg
atcaagcgtttcctggaggacaccacggatgatggagaactgagcaagttcgtgaaggat
ttctcaggaaatgcgagctgccacccaccagaggctaagacctgggcatccaggccccaa
gtcccggagccaaggccccaggccccggacctctatgatgatgacctggagttcagaccc
ccctcgcggccccagtcctctgacaaccagcagtacttctgtgccccagcccctctcagc
ccatctgccaggccccgcagcccatggggcaagcttgatccctatgattcctctgaggat
gacaaggagtatgtgggctttgcaaccctccccaaccaagtccaccgaaagtccgtgaag
aaaggctttgactttaccctcatggtggcaggagagtctggcctgggcaaatccacactt
gtcaatagcctcttcctcactgatctgtaccgggaccggaaacttcttggtgctgaagag
aggatcatgcaaactgtggagatcactaagcatgcagtggacatagaagagaagggtgtg
aggctgcggctcaccattgtggacacaccaggttttggggatgcagtcaacaacacagag
tgctggaagcctgtggcagaatacattgatcagcagtttgagcagtatttccgagacgag
agtggcctgaaccgaaagaacatccaagacaacagggtgcactgctgcctgtacttcatc
tcacccttcggccatgggctccggccattggatgttgaattcatgaaggccctgcatcag
cgggtcaacatcgtgcctatcctggctaaggcagacacactgacacctcccgaagtggac
cacaagaaacgcaaaatccgggaggagattgagcattttggaatcaagatctatcaattc
ccagactgtgactctgatgaggatgaggacttcaaattgcaggaccaagccctaaaggaa
agcatcccatttgcagtaattggcagcaacactgtagtagaggccagagggcggcgagtt
cggggtcgactctacccctggggcatcgtggaagtggaaaacccagggcactgcgacttt
gtgaagctgaggacaatgctggtacgtacccacatgcaggacctgaaggatgtgacacgg
gagacacattatgagaactaccgggcacagtgcatccagagcatgacccgcctggtggtg
aaggaacggaatcgcaacaaactgactcgggaaagtggtaccgacttccccatccctgct
gtcccaccagggacagatccagaaactgagaagcttatccgagagaaagatgaggagctg
cggcggatgcaggagatgctacacaaaatacaaaaacagatgaaggagaactattaa

DBGET integrated database retrieval system