KEGG   Homo sapiens (human): 541465Help
Entry
541465            CDS       T01001                                 

Gene name
CT45A6, CT45-5, CT45-6, CT45.6, CT45A5, CT45A7
Definition
(RefSeq) cancer/testis antigen family 45 member A6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: INT_SG_DDX_CT_C
Motif
Other DBs
NCBI-GeneID: 541465
NCBI-ProteinID: NP_001017438
OMIM: 300797
HGNC: 33271
Ensembl: ENSG00000278289
Vega: OTTHUMG00000188604
Pharos: P0DMV0(Tdark) P0DMU8(Tdark) P0DMU7(Tdark)
UniProt: P0DMU8 P0DMU7 P0DMV0
Position
Xq26.3
AA seq 189 aa AA seqDB search
MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMT
GHAIPPSQLDSQIDDFTGFSKDGMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQR
EINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKH
LKKKLKRMI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataaaacagagaaggtggctgtagatcctgaaactgtgtttaaacgtcccagg
gaatgtgacagtccttcgtatcagaaaaggcagaggatggccctgttggcaaggaaacaa
ggagcaggagacagccttattgcaggctctgccatgtccaaagaaaagaagcttatgaca
ggacatgctattccacccagccaattggattctcagattgatgacttcactggtttcagc
aaagatgggatgatgcagaaacctggtagcaatgcacctgtgggaggaaacgttaccagc
agtttctctggagatgacctagaatgcagagaaacagcctcctctcccaaaagccaacga
gaaattaatgctgatataaaacgtaaattagtgaaggaactccgatgcgttggacaaaaa
tatgaaaaaatcttcgaaatgcttgaaggagtgcaaggacctactgcagtcaggaagcga
ttttttgaatccatcatcaaggaagcagcaagatgtatgagacgagactttgttaagcac
cttaagaagaaactgaaacgtatgatttga

DBGET integrated database retrieval system