KEGG   Homo sapiens (human): 541565
Entry
541565            CDS       T01001                                 
Symbol
C8orf58
Name
(RefSeq) chromosome 8 open reading frame 58
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4657
Other DBs
NCBI-GeneID: 541565
NCBI-ProteinID: NP_001013864
HGNC: 32233
Ensembl: ENSG00000241852
Pharos: Q8NAV2(Tdark)
UniProt: Q8NAV2
Position
8:22599599..22604142
AA seq 365 aa
MMGRRRAFAVDGRDGAGEGLARGCIVPGVTSTYRRIPDAAHGCSSWERGDKFRGVGREAL
FLKLASRDSGVEMAVGDSPLAALPGLSQDSLDFESSGSSEPPAQVGRLLASQKLGEVLER
SRRLPTAPTSLSGQHRSLRLASKPEREVPLGAGQQESMEADTDLEAGLEEEAVGGLGPGA
WACLPGQGLRYLEHLCLVLEQMARLQQLYLQLRIQRPPGDPGEEESTRAPLPSPLHTPGN
RGQGPWELLSQTEHTGAKAASPPKVEVPSANPPRLPETPVEPTYHLPSSQGHKRDISHWD
KVKVLLNRICRRSHHHPEPPAPPDGSDPRIESRDLPERPQCRPHRKTFMPSLVVKKQRAK
NLSVG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgatgggccggcggcgcgccttcgccgtggacggccgggatggggctggcgagggcctg
gcacggggctgcatagtgcctggagtcaccagcacctacagacggatccccgacgctgcc
cacgggtgctcatcctgggagagaggtgacaagttcagaggtgtcggcagggaggcactc
tttctcaaactggcctcccgggactcaggagtggagatggcagttggggacagccccctg
gccgccttaccgggcctttctcaggactccctggactttgaatcctcagggagttctgag
ccccccgcccaggtaggccgactcctggccagccagaagctgggggaggtgttggagcgg
tcccgccggctcccaacagctcccaccagcttgtcaggacaacaccgctccctgcggctg
gcaagcaagcctgagcgtgaagtgccccttggagcagggcaacaggagtccatggaggca
gacacagacctagaggcaggcctggaagaagaggcggtggggggcctggggcctggagcc
tgggcctgcctccccgggcagggtcttcgctatctggaacacctgtgcctggtgctggag
cagatggcaaggctccagcagctctacctgcagctgcggatccagaggcccccaggggat
cccggcgaggaggagtcgacccgagcccctttaccgtccccgttacacaccccaggcaat
cgggggcaggggccatgggagctgctaagccagacagagcacacaggagcaaaggctgct
tcacccccaaaggtggaggtgcccagtgccaaccctcccaggctgccagaaaccccagtg
gagccaacgtaccacttgccatcctcccagggacacaagcgggatatctcccactgggac
aaggtcaaggtcctgctcaaccggatctgccggagaagccaccaccaccctgagccccct
gcccctcctgatggctctgaccccaggatcgagtccagggacctccctgaaaggcctcag
tgccgcccccaccggaagacctttatgccatcattagtggttaagaagcaacgagcaaaa
aacctttctgtaggctga

DBGET integrated database retrieval system