KEGG   Homo sapiens (human): 5420Help
Entry
5420              CDS       T01001                                 

Gene name
PODXL, Gp200, PC, PCLP, PCLP-1
Definition
(RefSeq) podocalyxin like
  KO
K06817  podocalyxin-like
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    5420 (PODXL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD34_antigen
Motif
Other DBs
NCBI-GeneID: 5420
NCBI-ProteinID: NP_001018121
OMIM: 602632
HGNC: 9171
Ensembl: ENSG00000128567
Vega: OTTHUMG00000154918
Pharos: O00592(Tbio)
UniProt: O00592 Q96N83
Position
7q32.3
AA seq 558 aa AA seqDB search
MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDT
AQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTI
ESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT
PHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVF
HHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTS
PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLN
LTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLP
AKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSMPLIITIVCMASFLLLVAALY
GCCHQRLSQRKDQQRLTEELQTVENGYHDNPTLEVMETSSEMQEKKVVSLNGELGDSWIV
PLDNLTKDDLDEEEDTHL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgcgcgctggcgctctcggcgctgctgctactgttgtcaacgccgccgctgctg
ccgtcgtcgccgtcgccgtcgccgtcgccctcccagaatgcaacccagactactacggac
tcatctaacaaaacagcaccgactccagcatccagtgtcaccatcatggctacagataca
gcccagcagagcacagtccccacttccaaggccaacgaaatcttggcctcggtcaaggcg
accacccttggtgtatccagtgactcaccggggactacaaccctggctcagcaagtctca
ggcccagtcaacactaccgtggctagaggaggcggctcaggcaaccctactaccaccatc
gagagccccaagagcacaaaaagtgcagacaccactacagttgcaacctccacagccaca
gctaaacctaacaccacaagcagccagaatggagcagaagatacaacaaactctgggggg
aaaagcagccacagtgtgaccacagacctcacatccactaaggcagaacatctgacgacc
cctcaccctacaagtccacttagcccccgacaacccacttcgacgcatcctgtggccacc
ccaacaagctcgggacatgaccatcttatgaaaatttcaagcagttcaagcactgtggct
atccctggctacaccttcacaagcccggggatgaccaccaccctactagagacagtgttt
caccatgtcagccaggctggtcttgaactcctgacctcgggtgatctgcccaccttggcc
tcccaaagtgctgggattacagcgtcatcggttatctcgcaaagaactcaacagacctcc
agtcagatgccagccagctctacggccccttcctcccaggagacagtgcagcccacgagc
ccggcaacggcattgagaacacctaccctgccagagaccatgagctccagccccacagca
gcatcaactacccaccgataccccaaaacaccttctcccactgtggctcatgagagtaac
tgggcaaagtgtgaggatcttgagacacagacacagagtgagaagcagctcgtcctgaac
ctcacaggaaacaccctctgtgcagggggcgcttcggatgagaaattgatctcactgata
tgccgagcagtcaaagccaccttcaacccggcccaagataagtgcggcatacggctggca
tctgttccaggaagtcagaccgtggtcgtcaaagaaatcactattcacactaagctccct
gccaaggatgtgtacgagcggctgaaggacaaatgggatgaactaaaggaggcaggggtc
agtgacatgaagctaggggaccaggggccaccggaggaggccgaggaccgcttcagcatg
cccctcatcatcaccatcgtctgcatggcatcattcctgctcctcgtggcggccctctat
ggctgctgccaccagcgcctctcccagaggaaggaccagcagcggctaacagaggagctg
cagacagtggagaatggttaccatgacaacccaacactggaagtgatggagacctcttct
gagatgcaggagaagaaggtggtcagcctcaacggggagctgggggacagctggatcgtc
cctctggacaacctgaccaaggacgacctggatgaggaggaagacacacacctctag

DBGET integrated database retrieval system