KEGG   Homo sapiens (human): 5420
Entry
5420              CDS       T01001                                 

Gene name
PODXL, Gp200, PC, PCLP, PCLP-1, PDX, PODXL1, gp135
Definition
(RefSeq) podocalyxin like
  KO
K06817  podocalyxin-like
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5420 (PODXL)
SSDB
Motif
Pfam: CD34_antigen
Other DBs
NCBI-GeneID: 5420
NCBI-ProteinID: NP_001018121
OMIM: 602632
HGNC: 9171
Ensembl: ENSG00000128567
Vega: OTTHUMG00000154918
Pharos: O00592(Tbio)
UniProt: O00592 Q96N83
Position
7q32.3
AA seq 558 aa
MRCALALSALLLLLSTPPLLPSSPSPSPSPSQNATQTTTDSSNKTAPTPASSVTIMATDT
AQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTI
ESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT
PHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVF
HHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTS
PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLN
LTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLP
AKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSMPLIITIVCMASFLLLVAALY
GCCHQRLSQRKDQQRLTEELQTVENGYHDNPTLEVMETSSEMQEKKVVSLNGELGDSWIV
PLDNLTKDDLDEEEDTHL
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgcgctgcgcgctggcgctctcggcgctgctgctactgttgtcaacgccgccgctgctg
ccgtcgtcgccgtcgccgtcgccgtcgccctcccagaatgcaacccagactactacggac
tcatctaacaaaacagcaccgactccagcatccagtgtcaccatcatggctacagataca
gcccagcagagcacagtccccacttccaaggccaacgaaatcttggcctcggtcaaggcg
accacccttggtgtatccagtgactcaccggggactacaaccctggctcagcaagtctca
ggcccagtcaacactaccgtggctagaggaggcggctcaggcaaccctactaccaccatc
gagagccccaagagcacaaaaagtgcagacaccactacagttgcaacctccacagccaca
gctaaacctaacaccacaagcagccagaatggagcagaagatacaacaaactctgggggg
aaaagcagccacagtgtgaccacagacctcacatccactaaggcagaacatctgacgacc
cctcaccctacaagtccacttagcccccgacaacccacttcgacgcatcctgtggccacc
ccaacaagctcgggacatgaccatcttatgaaaatttcaagcagttcaagcactgtggct
atccctggctacaccttcacaagcccggggatgaccaccaccctactagagacagtgttt
caccatgtcagccaggctggtcttgaactcctgacctcgggtgatctgcccaccttggcc
tcccaaagtgctgggattacagcgtcatcggttatctcgcaaagaactcaacagacctcc
agtcagatgccagccagctctacggccccttcctcccaggagacagtgcagcccacgagc
ccggcaacggcattgagaacacctaccctgccagagaccatgagctccagccccacagca
gcatcaactacccaccgataccccaaaacaccttctcccactgtggctcatgagagtaac
tgggcaaagtgtgaggatcttgagacacagacacagagtgagaagcagctcgtcctgaac
ctcacaggaaacaccctctgtgcagggggcgcttcggatgagaaattgatctcactgata
tgccgagcagtcaaagccaccttcaacccggcccaagataagtgcggcatacggctggca
tctgttccaggaagtcagaccgtggtcgtcaaagaaatcactattcacactaagctccct
gccaaggatgtgtacgagcggctgaaggacaaatgggatgaactaaaggaggcaggggtc
agtgacatgaagctaggggaccaggggccaccggaggaggccgaggaccgcttcagcatg
cccctcatcatcaccatcgtctgcatggcatcattcctgctcctcgtggcggccctctat
ggctgctgccaccagcgcctctcccagaggaaggaccagcagcggctaacagaggagctg
cagacagtggagaatggttaccatgacaacccaacactggaagtgatggagacctcttct
gagatgcaggagaagaaggtggtcagcctcaacggggagctgggggacagctggatcgtc
cctctggacaacctgaccaaggacgacctggatgaggaggaagacacacacctctag

DBGET integrated database retrieval system