KEGG   Homo sapiens (human): 54205Help
Entry
54205             CDS       T01001                                 

Gene name
CYCS, CYC, HCS, THC4
Definition
(RefSeq) cytochrome c, somatic
  KO
K08738  cytochrome c
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05016  Huntington disease
hsa05134  Legionellosis
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05222  Small cell lung cancer
hsa05416  Viral myocarditis
Network
N00098  Intrinsic apoptotic pathway
N00099  Mutation-inactivated BAX to apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00164  KSHV vBCL2 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00425  HCMV UL36 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00426  HCMV UL37x1 to crosstalk between extrinsic and intrinsic apoptotic pathways
Disease
H00978  Thrombocytopenia (THC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    54205 (CYCS)
   04215 Apoptosis - multiple species
    54205 (CYCS)
   04115 p53 signaling pathway
    54205 (CYCS)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    54205 (CYCS)
   05210 Colorectal cancer
    54205 (CYCS)
   05222 Small cell lung cancer
    54205 (CYCS)
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    54205 (CYCS)
   05012 Parkinson disease
    54205 (CYCS)
   05014 Amyotrophic lateral sclerosis (ALS)
    54205 (CYCS)
   05016 Huntington disease
    54205 (CYCS)
  09165 Cardiovascular diseases
   05416 Viral myocarditis
    54205 (CYCS)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    54205 (CYCS)
  09167 Infectious diseases
   05134 Legionellosis
    54205 (CYCS)
   05152 Tuberculosis
    54205 (CYCS)
   05164 Influenza A
    54205 (CYCS)
   05161 Hepatitis B
    54205 (CYCS)
   05168 Herpes simplex infection
    54205 (CYCS)
   05163 Human cytomegalovirus infection
    54205 (CYCS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    54205 (CYCS)
   05145 Toxoplasmosis
    54205 (CYCS)
  09168 Drug resistance
   01524 Platinum drug resistance
    54205 (CYCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 54205
NCBI-ProteinID: NP_061820
OMIM: 123970
HGNC: 19986
Ensembl: ENSG00000172115
Vega: OTTHUMG00000128495
Pharos: P99999(Tbio)
UniProt: P99999 G4XXL9
Structure
PDB: 

Position
7p15.3
AA seq 105 aa AA seqDB search
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctctttgggcggaag
acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcatcatctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgtcggcattaagaagaaggaagaaagggcagacttaatagcttatctcaaa
aaagctactaatgagtaa

DBGET integrated database retrieval system